Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.59
PubTator Score 8.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Age related macular degeneration 71 3.545 1.8
Myopia 175 3.528 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 3.6e-02

Gene RIF (4)

AA Sequence

MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSD      1 - 70
ESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVI     71 - 140
SSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDP    141 - 210
ETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRT    211 - 280
THRLLFRCPRLLNLGLQCLSCGCLPTRVRPR                                           281 - 311
//

Text Mined References (13)

PMID Year Title