Property Summary

NCBI Gene PubMed Count 62
PubMed Score 81.20
PubTator Score 58.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colonic Neoplasms 142 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Allergic hypersensitivity disease 126 3.551 1.8
FG syndrome 16 3.322 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
dermatomyositis 1.100 4.4e-03
medulloblastoma, large-cell -1.100 3.0e-05
ovarian cancer 1.600 3.1e-03
sonic hedgehog group medulloblastoma 1.200 1.3e-03

Protein-protein Interaction (2)

PDB (44)

Gene RIF (27)

AA Sequence

MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQN      1 - 70
KSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSP     71 - 140
NQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFH    141 - 210
GKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQN    211 - 280
KESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKR    281 - 350
QIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQV    351 - 420
KNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS         421 - 485
//

Text Mined References (71)

PMID Year Title