Property Summary

NCBI Gene PubMed Count 272
PubMed Score 524.89
PubTator Score 1314.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Microphthalmia 79 0.0 4.0

Expression

  Differential Expression (34)

Disease log2 FC p
malignant mesothelioma -2.600 5.6e-08
astrocytic glioma -3.600 1.1e-03
oligodendroglioma -3.400 3.7e-03
psoriasis 1.900 1.7e-03
glioblastoma multiforme -3.000 3.0e-29
posterior fossa group B ependymoma -2.700 1.4e-05
medulloblastoma -3.600 4.0e-06
cystic fibrosis 1.500 1.9e-02
atypical teratoid / rhabdoid tumor -3.000 1.1e-04
primitive neuroectodermal tumor -2.500 1.3e-02
autosomal dominant Emery-Dreifuss muscul... 2.106 6.7e-03
acute quadriplegic myopathy 1.545 2.5e-04
Atopic dermatitis -2.300 8.1e-03
adrenocortical adenoma -2.976 4.4e-04
adrenocortical carcinoma -2.944 2.1e-05
non-small cell lung cancer -2.285 3.0e-18
lung cancer -1.800 1.0e-04
active ulcerative colitis 1.720 3.3e-02
sarcoidosis -1.900 2.7e-02
breast carcinoma -3.300 1.3e-03
fibroadenoma -4.000 1.3e-02
interstitial cystitis -3.500 3.9e-04
lung adenocarcinoma -2.000 1.3e-07
adult high grade glioma -3.300 1.5e-03
pilocytic astrocytoma -3.700 4.1e-07
non primary Sjogren syndrome sicca 1.800 1.4e-02
aldosterone-producing adenoma -2.686 3.2e-03
inflammatory breast cancer -1.800 1.4e-02
lung carcinoma -3.000 3.9e-14
Pick disease -1.100 5.5e-03
ductal carcinoma in situ -4.400 1.9e-04
invasive ductal carcinoma -5.500 8.6e-05
ovarian cancer -1.700 2.4e-09
pituitary cancer -3.500 1.1e-02

Protein-protein Interaction (9)

Gene RIF (239)

PMID Text
26962819 Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients.
26927700 RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls.
26731992 Elevated serum RBP4 level is one of the important risk factors for both carotid artery plaque formation and CHD in Chinese
26619134 male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots
26575118 RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction.
26526443 This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation.
26440092 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance
26425827 RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres.
26178727 Data suggest that RBP4 saturated with retinol, elevated carotenoids (hypercarotenemia), and elevated retinyl esters can be used as biological markers in serum of excessive stores of vitamin A in liver of preschool children with hypervitaminosis A.
26069091 Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio.
26055327 Transgenic mice overexpressing human RBP4 (RBP4-Tg mice) develop progressive retinal degeneration, characterized by photoreceptor ribbon synapse deficiency and subsequent bipolar cell loss.
25941915 This review attempts to describe and summarize the variety of published mechanisms of how RBP4 can interfere with insulin signaling; these mechanisms are dissected in regard to involving retinol transport and newly-identified RBP4 membrane receptors. [Review]
25910211 Study identified missense mutations in RBP4, encoding serum retinol binding protein, in three families with eye malformations of differing severity, including bilateral anophthalmia.
25875385 RBP4 induces vascular oxidative damage and accelerates the development of atherosclerosis.
25810022 Baseline serum RBP4 levels were independently associated with incident diabetes in Asian Indian men with impaired glucose tolerance.
25712946 Serum levels of retinol-binding protein 4 and risk of colon adenoma
25703255 Findings suggested that Asian women with gestational diabetes mellitus had increased circulating RBP4 levels in their second/third trimester. [Meta-Analysis]
25701600 variations in the RBP4 gene were correlated with body mass index and polymorphisms more likely could contribute to the development of obesity in this population
25633269 First-trimester maternal serum RBP4 was significantly increased and PAPP-A decreased in pregnancies that ended in early-onset preeclampsia compared to normal pregnancies.
25479076 The RBP4 rs7094671 single nucleotide polymorphism is associated with coronary artery disease.
25450816 RBP4 concentration had a correlation with Resting Metabolic Rate which was different among obese and non-obese groups. These results may suggest the possible role of RBP4 in alteration of metabolic rate through insulin or other metabolic effects.
25437889 Plasma RBP4 levels are significantly associated with coronary lesion complexity in women with stable coronary artery disease and acute coronary syndrome and predict incident cardiovascular events
25299197 we showed that successful kidney transplantation significantly decreases elevated serum RBP4 concentrations in patients with ESRD.
25250314 Our results suggested that RBP4 is a potential biomarker for diagnostic of screening ovarian cancer.
25233041 Serum RBP4 concentrations were significantly higher in the coronary artery disease (CAD) and hyperinsulinema group than in the CAD and control groups. RBP4 concentration was significantly associated with cardiovascular risk factors.
25227411 Presence of gestational diabetes mellitus risk factors does not have an impact on early second trimester RBP-4 values in pregnant subjects.
25142320 Patients with coronary artery disease showed elevated serum levels of RBP4.
25069671 The RBP4 level was higher in polycystic ovary syndrome patients than in non-patients
24956535 RBP4 serum levels were significantly elevated in patients with established carotid atherosclerosis and were positively associated with atherosclerosis severity.
24800810 Including Fetuin-A and Retinol binding protein 4.
24784414 Taken together, this study provided information on the proteome profile of the hepatitis C virus-infected Indian population, and revealed a link between hepatitis C virus infection, RBP4 and insulin resistance.
24720534 Serum RBP4 was decreased in men with acute myocardial infarction compared to controls. RBP4 was decreased in men with familial hypercholesterolemia who subsequently had a cardiovascular episodes compared to those with FH and no cardiovascular episode.
24665145 Two RBP4 SNPs showed associations with insulin resistance and insulin levels in women with prior gestational diabetes mellitus.
24651174 Retinol binding protein 4 concentrations relate to enhanced atherosclerosis in obese patients with rheumatoid arthritis.
24647386 Our study indicates that plasma RBP4 is independently associated with the 6-y risk of developing type 2 diabetes.
24606904 Transfer of RBP4-activated antigen-presenting cells into normal mice is sufficient to induce adipose tissue inflammation, insulin resistance, and glucose intolerance.
24593134 retinol-binding protein-4/adiponectin and leptin/adiponectin ratios have roles in inflammation; RBP4/adiponectin only have roles in insulin resistance
24532832 RBP4 does not correlate with the presence of insulin resistance and beta-cell function in patients with rheumatoid arthritis.
24397358 serum RBP4 levels are elevated in gestational diabetes cases compared with controls.
24367155 the correlations of visfatin/Nampt, vaspin, and RBP-4 with insulin resistance are tissue dependent.
24160775 Serum RBP4, secreted mainly by liver and adipose tissue, may be involved in the pathogenesis of beta cell dysfunction in Chinese women with non-alcoholic fatty liver disease.
24044566 adiponectin, resistin and RBP4 may have a role in the pathogenesis of NAFLD in obese children
24011638 The aim of the study was to evaluate the influence of vertical banded gastroplasty on peripheral blood concentrations of some adipocytokines and hormones involved in the control of food intake and energy turnover.
23979787 Fatty acid-binding protein 4 levels increased and retinol-binding protein 4 levels did not change during moderate weight loss in obese women with metabolic syndrome.
23799122 Circulating levels of lipocalin-2 and RBP4 are positively correlated with carotid IMT and subclinical atherosclerosis in type 2 diabetes, which suggests a role of these two lipid-binding chaperones in the pathogenesis of vascular complications of diabetes
23764679 insulin resistance and plasma retinol-binding protein 4 showed significant associations with obesity and traditional cardiovascular disease risk factors
23734806 Adiponectin, RBP4 and resistin levels are associated with metabolic syndrome in pubertal obese children.
23708710 expression of retinol-binding protein 4 (RBP4) and placenta-specific 8 increased in the bone tumors of PC3-GFP/PC3-OPG-injected mice. Knockdown of both RBP4 and PLAC8 by siRNA inhibited the growth of PC-3 cells in vitro.
23584360 In a cohort of women, higher circulating full-length and total RBP4 levels are associated with increased risk of coronary heart disease.
23571154 These findings suggest that kisspeptin, leptin, and RBP4 are associated with metabolic disturbances in women with polycystic ovaries.
23480783 Insulin sensitizing and lipid lowering therapies do not affect free fatty acid binding protein (FABP)4 or RBP4 levels in polycystic ovary syndrome patients.
23460908 IL-1beta was identified as a major factor contributing to the decrease in RBP4.
23420326 Elevated RBP4 is associated with the morbidity of cholesterol gallstones and metabolic syndrome.
23418565 Data indicate that leptin and retinol-binding protein 4 were markedly down-regulated in encapsulating peritoneal sclerosis (EPS) peritoneal dialysis (PD) tissue.
23350588 RBP4 seems to play a role as early marker of fetal growth retardation but not preeclampsia in first trimester maternal serum.
23242471 these results point to lipocalin-2 and RBP-4 as relevant mediators of the trend towards metabolic syndrome in psoriatic patients.
23189188 This study identifies the RBP4 splice site change as the cause of Retinitis Pigmentosa in this pedigree.
23153527 Data suggest a modest up-regulation of serum RBP4 concentration in early pregnancy (16 weeks) in gestational diabetes (GDM) particularly among women with advanced age (>35 years); thus serum RBP4 may serve as a biological marker for risk of GDM.
23145084 RBP4 -803GA polymorphism has increased risk of insulin resistance in HIV-infected patients with anti-retroviral therapy.
23129325 The plasma TTR levels appear to be an important determinant of plasma RBP4 levels in type 1 and type 2 diabetes mellitus.
23119072 Results indicate a significant correlation between serum RBP4 and various established risk factors for cardiovascular disease (CVD) and suggest RBP4 may serve as an independent predictor of CVD in women.
23105095 expression of RBPR2 in liver and fat suggests a possible role in mediating established metabolic actions of RBP4 in those tissues
23087360 Retinol-binding protein 4 may be involved in the pathophysiology of hypertriglyceridemia in type 2 diabetes mellitus by reducing very low-density lipoprotein catabolism.
23074124 Data revealed a strong correlation between RBP-4 and the number of components of metabolic syndrome in HIV-infected subjects receiving HAART.
23073835 The function of Rpb4 interaction with rpb7 in human cells indicate that Rpb4 have gene-specific effects but are also more generally required for human cell survival.
23071093 RBP4 induces inflammation in primary retinal capillary endothelial cells and umbilical vein endothelial cells by stimulating expression of proinflammatory molecules involved in leukocyte recruitment and adherence to endothelium
23020231 Elevated serum RBP-4 and NGAL are associated with pancreatic cancer.
22971483 Serum RBP4 may be a useful marker of overall metabolic control in Chinese patients with type 2 diabetes mellitus.
22878527 Speculate that in suture mesenchymal cells, endogenous RBP4 receives retinol from STRA6 and the RBP4-retinol complex is stored in vesicles until needed for conversion to retinoic acid in the process of osteogenesis.
22863748 A prompt increase in exercise-induced RBP4 is retarded by progression of nephropathy.
22855337 Circulating levels of fetuin-A, RBP4, and FABP4 are associated with insulin resistance and with distinct components of metabolic syndrome consistent with the multifactorial pathogenesis of metabolic dysregulation.
22826435 TTR blocks the ability of holo-retinol-binding protein to associate with STRA6 and thereby effectively suppresses both STRA6-mediated retinol uptake and STRA6-initiated cell signaling.
22800884 Smoking may have effect on insulin sensitivity, which is correlated with retinol-binding protein-4.
22785609 These findings implicate RBP4 in the cascade of reversible metabolic derangements in advanced heart failure.
22685600 Data indicate that in the disease group, leptin, leptin/adiponectin ratio, fetuin-A and retinol-binding protein 4 (RBP4) levels were remarkably lower than in the no-symptom group
22491740 retinol binding protein 4 disturb insulin receptor substrate 1 activity and expression in megakaryocytes. This might be a cause of the insulin resistance observed in platelets from patients with type 2 diabetes.
22426023 RBP4 may play an important role in lipid metabolism of atherosclerosis, particularly in formation of sdLDL.
22397743 RBP4 level reflects visceral body fat content in non-polycystic ovary syndrome women.
22308842 In early- to mid-adolescents, circulating concentrations of RBP4 are correlated with multiple risk factors for adiposity-related co-morbidities.
22308028 the increase of apo-/holo-RBP4 concentration may influence STRA6 signaling, finally causing apoptosis.
22253430 RBP4 may have a role in insulin resistance and risk for type 2 diabetes and metabolic syndrome
22205567 RBP(4) has been shown to induce insulin resistance, and plasma RBP(4) values are increased in type 2 diabetes mellitus, obesity, metabolic syndrome, and cardiovascular disease.
22151390 serum level decreased in psoriasis
22086013 RBP4 G-803A and T-179G polymorphisms might be associated with the development of type 2 diabetic and affect the therapeutic efficacy of rosignitazone in Chinese T2DM patients.
22068556 genetic association studies in population of children in Germany: Data suggest that SNP in promoter region of RBP4 (-803G>A; rs3758539) is not associated with overweight/obesity, type 2 diabetes, or hypertension in Caucasian children.
22023042 The elevation of RBP4 levels in polycystic ovary syndrome women might be influenced by androgen hormones.
22020625 We verified the decrease of RBP4 levels in ovarian cancer patient sera by two independent methods.
21939650 Plasma RBP-4 correlated positively with liver fat and insulin resistance which may reflect its effects on hepatic insulin sensitivity
21886308 the rs3758539 retinol binding protein 4 single nucleotide polymorphism was not found to be associated with gestational diabetes.
21835764 This review summarizes up-to-date knowledge of RBP4's controversial role as an adipokine linked to obesity, development of insulin resistance, and type 2 diabetes.
21821833 RBP4 haplotypes is important in genetically modulating renal function in response to environmental challenges among patients with Type 2 diabetes.
21817822 Data suggest that serum RBP4 concentrations are elevated in type 2 diabetic subjects with chronic kidney disease in Taiwan; this observation was not associated with higher carotid intima-media thickness in these subjects.
21741059 A higher degree of IR in the GDM group compared with the non-GDM group, but serum RBP4 levels between the 2 groups were not different.
21655067 Serum RBP4 level is related with degree of adiposity and pubertal development in children and adolescent.
21645024 These findings suggest a differential regulation of RBP4 production in epicardial adipose tissue and subcutaneous adipose tissue that may be influenced by local factors.
21617096 Higher RBP4 levels were associated with a higher prevalence of prediabetics with impaired glucose regulation, as well as a greater frequency of obesity, hypertension, and higher alcohol consumption
21609194 The elevated expression of RBP4 in subcutaneous adipose tissue may contribute to the increase in circulating RBP4 in gestational diabetes subjects.
21600576 Leptin, serum retinol-binding protein 4, and asymmetric dimethylarginine levels are positively correlated in polycystic ovary syndrome.
21458418 RBP4 has a robust acute effect of enhancement of NO production via stimulation of part of the PI3K/Akt/eNOS pathway and inhibition of ERK1/2 phosphorylation and insulin-induced ET-1 secretion.
21406189 Nampt and RBP4 serum concentrations did not correlate with the maximum percentage of carotid stenosis
21383997 RBP-4 can be considered as a convenient serum marker of intrahepatic lipid content in obese children.
21299359 both maternal and umbilical cord serum retinol-binding protein-4 (RBP4) levels were lower in patients with preeclampsia than in normal pregnant women in the third trimester of pregnancy
21223811 A high expression of RBP4 in omental adipose tissue and an elevated level of serum RBP4 may contribute to the pathogenesis of obesity and insulin resistance.
21176857 Data found high serum A-FABP4 but unchanged RBP4 concentrations and their associations with renal function and early diabetic nephropathy in type 2 DM.
21173508 data suggest that RBP4 might act in the pathophysiology of late-onset preeclampsia via increased insulin resistance in obese women.
21164503 investigation of influence of low birth weight (and subsequent infant overfeeding) and short-term high fat overfeeding of young men on plasma RBP4; RBP4 does not appear to contribute to short-term diet-induced insulin resistance
21106915 no independent association between RBP4 concentrations and development of the metabolic syndrome.
21104585 RBP-4, lipocalin-2 and L-PGDS do not regulate insulin sensitivity in healthy men.
21085476 Data show that comparing to T2D the IFG subjects had higher serum chemerin, progranulin, fetuin-A and RBP4 levels which was not detectable in the comparison of the T2D and IGT group.
21039728 Adipose tissue -derived RBP4-mRNA expression is gender specific and regulated by leptin. Circulating RBP4 levels appear to be independent of AT-RBP4 secretion.
20950077 RBP4 is a marker of adipose tissue mass and obesity already evident in children. The association of RBP4 with metabolic and cardiovascular sequelae of obesity appears to be secondary to the underlying relationship wtih body fat.
20932285 Strong associations with hepatic and renal function, insulin resistance and acute mortality suggest a role for RBP4 in the pathogenesis of critical illness.
20929509 Serum retinol-binding protein 4 is associated with insulin secretion in Chinese people with normal glucose tolerance
20849357 Sodium/lithium countertransport correlates negatively with adiponectin and RBP-4.
20819415 RBP4 decreased significantly in women with type 2 diabetes mellitus with resistance exercise.
20798476 Our study showed that increased levels of RBP4 as well as homeostasis model assessment of insulin resistance and high sensitivity c-reactive protein in women were significantly associated with increased levels of systolic blood pressure.
20646597 RBP4 mRNA expression in visceral adipose tissue was significantly higher in obesity and type 2 diabetes subjects than in normal controls.
20625434 Observational study of gene-disease association. (HuGE Navigator)
20610143 Circulating RBP4 decreases in cholesterol gallstone disease independent of renal function
20503483 Data show that retinol-binding protein 4 is reduced in small for gestational age newborns, and is not related to insulin sensitivity.
20436266 Serum retinol binding protein 4 level is related with renal functions in Type 2 diabetes.
20389103 Our results suggest a direct relationship between circulating insulin and RBP4 levels, which indicates that this protein might contribute to the development of muscle insulin resistance.
20376890 RBP4 was not associated with insulin resistance or metabolic indices and the predictive value for IR was minimal in hypertensives.
20233518 Elevated serum RBP4 levels are associated with proliferative diabetic retinopathy.
20224248 not associated with markers of glycemic control, insulin resistance or lipid profile in obstructive sleep apnea syndrome
20146659 RBP4 concentrations in maternal plasma may play a role in accelerated fetal growth in the absence of overt carbohydrate intolerance.
20097162 RBP4 serum concentration and the appearance of RBP4-LL seem to be influenced by kidney function. Furthermore, the RBP4-transthyretin ratio may provide diagnostic potential with regard to metabolic complications in chronic kidney disease patients.
20058618 Serum RBP-4 level was closely related to metabolic syndrome in first-degree relatives of type 2 diabetes mellitus.
19949653 Results show an association between RBP4 and pulmonary function in prepubertal male asthmatics, which may indirectly affect the high prevalence of childhood asthma in males.
19900011 among patients with preterm labor, the median amniotic fluid concentration of immunoreactive retinol binding protein 4 (RBP4) is elevated in pregnancies complicated by intra-amniotic infection/inflammation
19897788 Retinol-binding protein 4 concentrations in gestational diabetes patients were significantly higher than the normal women
19893506 genetic variations in RBP4 may play a role in the differences in serum HDL-C levels in the Newfoundland population
19893506 Observational study of gene-disease association. (HuGE Navigator)
19875582 In the circulation, RBP4 is the principal transport protein for retinol (vitamin A) (11) and is encoded by the RBP4 gene.
19857477 Data show that gestational diabetes mellitus is not associated with retinol-binding protein 4 or retinol among borderline obese pregnant women.
19851303 the minor allele of RBP4 regulatory SNP enhanced the expression in adipocytes, which may be associated with the adipogenesis.
19851303 Observational study of gene-disease association. (HuGE Navigator)
19820404 Serum RBP4 is not a predictive factor in nonalcoholic fatty liver disease irrespective of alanine aminotransferase .
19794289 RBP4 is correlated with adiposity and insulin resistance in obese children, but it is not involved in the insulin resistance occurring during puberty.
19766271 Serum RBP4 appears to identify age-induced insulin resistance by physiologic changes due to aging or menopause and by increasing hepatic glucose production
19765959 RBP4 level was enhanced by the presence of the apolipoprotein A-V-1131 T>C genetic variant in diabetes
19709697 RBP4 level was independently associated with uric acid level in patients with type 2 diabetes mellitus
19708829 Findings suggest a role for RBP4 in the pathogenesis of preterm preeclampsia, but not in small for gestational age and fetal death.
19671994 Serum RBP4 concentration is influenced by menopausal status and closely related to insulin resistance but not to the prevalence of T2DM in postmenopausal women.
19589139 During acute critical illness, circulating levels of adiponectin, RBP4, and leptin were low. Pts with sepsis had lower levels of leptin and RBP4 than did nonseptic pts. When critical illness was sustained, adipokine levels became normal reference values
19573524 Increased circulating AFABP and RBP-4 concentrations were demonstrated in patients with preeclampsia, suggesting it be an important pathophysiology of preeclampsia.
19556974 RBP4 levels are increased in naive hypertensive women & correlated with degree of carotid intima-media thickness suggesting a participation of this adipocytokine in modulation of the atherosclerotic process exerted by adipose tissue as endocrine organ.
19537932 results highlight the complexity behind the regulation of this adipokine and demonstrate that RBP4 expression in macrophages could be modulated by inflammatory stimuli
19525859 In adult patients with nonalcoholic fatty liver disease, serum RBP4 levels do not correlate with body mass index or insulin resistance; the study identifies a novel association between serum RBP4 levels and hepatocellular injury in these patients
19506831 Serum RBP4 level is closely associated with impaired glucose regulation and is an independent risk factor for microalbuminuria.
19501863 serum RBP4 is associated with obesity, insulin resistance, and dyslipidemia in HIV-infected subjects receiving highly active antiretroviral therapy
19501859 circulating RBP4 and transthyretin were not affected by human obesity or type 2 diabetes mellitus
19403191 Metabolic syndrome X is significantly associated with serum RBP4.
19369430 RBP4 circulating levels were not significantly correlated with obesity-related parameters
19346786 Serum RBP4 level was a distinguishing factor at the early stage of chronic liver disease between chronic hepatitis and Child-Pugh grade A cirrhosis
19339013 In elderly, RBP4 concentrations were associated with metabolic syndrome and its components in both sexes, and prior cerebrovascular disease in men.
19303000 RBP4-log levels were lower in patients with Familial Partial Lipodystrophy in comparison to control group.
19288010 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19287041 Observational study of gene-disease association. (HuGE Navigator)
19224430 Regulation of RBP4 expression and secretion occurs through biochemical pathways independent from those influenced by pioglitazone or simvastatin.
19217438 RBP4 did not correlate to clinical and biochemical measures of pregnancy outcome, renal function, glucose, and lipid metabolism in preeclampsia.
19195734 There is a positive relationship between RBP4 and IR in type 2 diabetic patients. RBP4 may play a role in pathogenesis of T2DM.
19190263 Plasma RBP4 levels are elevated in T2DM and associated with impaired glucose tolerance, but not associated with obesity or insulin resistance or impaired insulin secretion in Mexican Americans.
19169049 our findings do not confirm a link between insulin resistance, neither with RBP4 nor with free plasma RBP4 levels.
19158194 Patients with polycystic ovary syndrome and higher RBP4 concentrations are associated with higher androgen levels and higher clinical hirsutism.
19155083 An assessment of the correlation between RBP4 and disease severity of chronic hepatitis c infection.
19147488 Identification and characterization of a non-retinoid ligand for retinol-binding protein 4 which lowers serum retinol-binding protein 4 levels in vivo.
19122345 These results indicate an increase in serum RBP4 levels in the type 2 diabetic subjects, particularly complicated with advanced renal impairment.
19114616 Circulating RBP4 concentrations are associated with intima-media and plaque echogenicity in carotid arteries in aged people.
19088257 Fenofibrate inhibits RPB4 expression in dyslipidemic human subjects and inhibition of RBP4 expression in adipocytes may provide a mechanism by which fenofibrate improves insulin sensitivity in dyslipidemic patients.
19053019 directly compare fetal adiponectin and RBP-4 levels in respect to birth weight and maternal preconceptional BMI
19046959 Hemodyalysis and renal transplataion patients had elevated RBP4, apo-RBP4, RPB4-L levels.
19023195 RBP is elevated in nondiabetic stage 5 chronic kidney disease and correlates weakly with HbA1c and ApoA1.
19021760 The protein-protein interactions between transthyretin and plasma retinol-binding protein were analysed by structural (X-ray crystallography) and genetic (amino acid substitutions) methods.
19003725 Olasma RBP4 is associated with dyslipidemia, but not with insulin resistance, glucose intolerance, or hypertension in patients with obstructive sleep apnea syndrome.
18980783 conjugated linoleic acid did not induce changes in RBP4 concentrations in abdominally obese middle-aged men despite marked induced insulin resistance
18977339 RBP4 may be linked to IR and lipid metabolism, at least in the elderly.
18973209 Impaired renal clearance of diabetic nephropathy affects RBP4 and indirectly supports the hypothesized link among metabolic syndrome, uric acid and insulin resistance
18937078 The variations in the RBP4 gene may be associated with T2DM and serum triglyceride levels in the Han Chinese.
18937078 Observational study of gene-disease association. (HuGE Navigator)
18854400 Measurement of serum RBP4 does not provide added value for predicting CAD risk beyond traditional risk factors.
18852328 Data indicate that RBP4 levels in plasma, skeletal muscle, and fat may be linked to insulin resistance and type 2 diabetes in a secondary and noncausal manner.
18838136 Retinol-binding protein-4 is associated with endothelial dysfunction in adults with newly diagnosed type 2 diabetes mellitus.
18796616 Human data showing elevated RBP4 levels in type 2 diabetic patients may be the result of moderate renal insufficiency rather than support for the suggestion that RBP4 links obesity to type 2 diabetes.
18783798 Cohort study provides evidence that RBP4 may be a mechanism through which obesity influences insulin resistance and hypertriglyceridemia in overweight postpubertal black youth.
18782570 linkage between serum RBP4 and sdLDL-cholesterol levels in young adult women
18752671 The occurrence of RBP4 isoforms is not influenced by liver function but seems to be strongly related to kidney function and may therefore be important in investigating kidney function and related disorders.
18719670 There is a marked decrease of RBP-4 levels after bariatric surgery, which correlates with reduction in visceral-fat mass. The extent of changes in RBP-4 levels differs according to the severity of the metabolic syndrome.
18710473 There was no significant change in the lipocalin-2 and RBP4 levels, although IL-6 levels increased after the exercise programme in obese women
18641048 Investigations into the role of RBP in obesity and insulin resistance should include retinol to facilitate the measurement of apo-RBP and retinol:RBP.
18588869 This is the first report of a long-term longitudinal study on RBP and the major finding is that subjects who developed insulin resistance showed no change in plasma RBP.
18506842 In nondiabetic, nonobese patients with genotype 1 chronic hepatitis C, serum RBP4 levels might be expression of virus-linked pathway to steatosis, largely unrelated to insulin resistance.
18496666 Homozygosity for the RBP4 -803A allele is associated with increased risk of type 2 diabetes in the Rotterdam population.
18496666 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18493106 Weight reduction, especially the loss of abdominal visceral fat, lowers serum retinol binding protein-4(RBP4) concentrations in nondiabetic subjects indicating that RBP4 may be involved in improvement of insulin resistance and metabolic syndrome
18492757 The severity of glucose intolerance in women with previous gestational diabetes mellitus is associated with high RBP4 and low adiponectin concentrations.
18466349 RBP4 in cirrhosis (i) is decreased due to reduced hepatic production, (ii) is not associated with insulin resistance, and (iii) might have a beneficial role by decreasing hepatic glucose production and could thus also be regarded as a hepatokine
18445670 Although associated with visceral fat, serum RBP4 and adiponectin levels do not play important, fat-mass-independent primary roles in the development of PCOS.
18437353 RBP4 measured by two different techniques is not elevated, but the RBP4:retinol molar ratio is higher and correlates with fasting blood glucose in women with gestational diabetes
18426863 Relationship between circulating RBP4 and iron stores, both cross-sectional and after iron depletion, and in vitro findings suggest that iron could play a role in the RBP4-insulin resistance relationship.
18426837 Neither retinol nor RBP-4 were associated with peak bone mineral density in young men
18426814 Data show that increase in RBP4 from early to late pregnancy, associated with a decline in insulin sensitivity, potentially indicates interactions with glucose metabolism.
18397979 RBP4 levels were related to weight status and insulin resistance in both cross-sectional and longitudinal analyses.
18390799 RBP4 is not a useful marker of insulin resistance in polycystic ovary syndrome but may reflect other metabolic features of this condition.
18381580 RBP4 level could be used as an index of cardiovascular disease risk in subclinical hypothyroidism.
18316031 In fibroboasts, STRA6 transports retinol bidirectionally in an RBP4 dependent manner.
18239568 The associations of RBP4 with insulin sensitivity, percent trunk fat, and lipid levels are influenced by age
18199128 Observational study of gene-disease association. (HuGE Navigator)
18081728 RBP4 variation in the first month after RY-gastric bypass may be a predictor of weight loss success.
18052678 Report retinol-binding protein 4 expression in visceral and subcutaneous fat in human obesity.
17957146 Serum RBP4 and TTR showed no differences between controls/type 1 diabetic children.
17904683 Retinol binding protein 4 may contribute to the pathogenesis of nonalcoholic fatty liver disease in type 2 diabetics.
17890490 RBP4 may represent a link between visceral obesity and cardiovascular disease
17728376 Observational study of gene-disease association. (HuGE Navigator)
17728376 Role of RBP4 genetic variation in susceptibility to type 2 diabetes and insulin resistance, possibly through an effect on RBP4 expression.
17686833 In obese men with metabolic syndrome, weight loss with a low-fat diet decreases the plasma LDL apoB-100 and HDL lipoprotein kinetics, involving changes in RBP4 levels.
17661007 Contribution of RBP4 from adipocytes to circulating adipokine levels should be evaluated in diabetic and obese patienets.
17639305 RBP4 does not seem to be a valuable marker for identification of the metabolic syndrome or insulin resistance in male patients with type 2 diabetes or coronary artery diseae.
17630267 Markers of glucose and lipid metabolism were not independently related to serum RBP-4 in control subjects or chronic hemodialyis patients.
17618858 Serum retinol-binding protein is more highly expressed in visceral than in subcutaneous adipose tissue and is a marker of intra-abdominal fat mass
17595259 RBP4 gene expression in humans is associated with inflammatory markers, but not with insulin resistance
17575262 RBP4 may be released from diabetic adipocytes and act locally to inhibit phosphorylation of IRS1 at serine (307), a phosphorylation site that may integrate nutrient sensing with insulin signaling
17568782 Plasma RBP4 levels in type 2 diabetic patients are affected by incipient nephropathy.
17550959 RBP4 may contribute to the development of insulin resistance along with other adipokines
17526940 Serum retinol binding protein 4 levels are significantly increased in polycystic ovary syndrome women and associated with insulin resistance.
17456573 up-regulation of RBP4 mRNA in subcutaneous and omentum adipose tissue as well as isolated subcutaneous adipocytes of polycystic ovary syndrome women
17405846 Severe calorie restriction promotes a reduction in adipose tissue and plasma levels of RBP4.
17337499 RBP4 is not a relevant systemic factor in the pathogenesis of insulin resistance in liver cirrhosis.
17299074 there is a relationship between RBP4, insulin sensitivity, and percent trunk fat in individuals who may not have features of insulin resistance
17259477 Circulating RBP4 is not associated with the amount of fat in liver, skin, viscera or muscles.
17174134 Observational study of gene-disease association. (HuGE Navigator)
17174134 a haplotype of 8 common SNPs in Caucasians was significantly increased in type 2 diabetics compared with controls
17164313 Reductions in circulating RBP-4 may contribute to improved insulin resistance in morbidly obese subjects after weight loss.
17065684 Plasma RBP4 concentrations were found to be elevated in subjects with impaired glucose tolerance or type 2 diabetes and to be related to various clinical parameters known to be associated with insulin resistance
17006670 the rare alleles of four SNPs were associated with increased risk of diabetes (-803, G > A, P = 0.0054; +5169, C > T, P = 0.0025; +6969, G > C, P = 0.0015; +7542, T > del, P = 0.0015)
17003346 Our findings point to profound differences between rodents and humans in the regulation of adipose or circulating RBP4 and challenge the notion that glucose uptake by adipocytes has a dominant role in the regulation of RBP4.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16156801 generated models for the ensemble of conformers populated within this molten globule state; conformer changes give an opening of the retinol-binding site
15649951 Genetic variation in RBP4 is associated with amyloid polyneuropathy

AA Sequence

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ      1 - 70
MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL     71 - 140
LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL             141 - 201
//

Text Mined References (274)

PMID Year Title
26962819 2016 GC Gene Polymorphism and Unbound Serum Retinol-Binding Protein 4 Are Related to the Risk of Insulin Resistance in Patients With Chronic Hepatitis C: A Prospective Cross-Sectional Study.
26927700 2016 Retinoid and carotenoid status in serum and liver among patients at high-risk for liver cancer.
26731992 2015 Serum Retinol-Binding Protein-4 Level is a High Risk Factor for Coronary Heart Disease in Chinese.
26619134 2016 Male mice are susceptible to high fat diet-induced hyperglycaemia and display increased circulatory retinol binding protein 4 (RBP4) levels and its expression in visceral adipose depots.
26575118 2016 Retinol Binding Protein-4 and Adiponectin Levels in Thyroid Overt and Subclinical Dysfunction.
26526443 2016 Plasmatic retinol-binding protein 4 and glial fibrillary acidic protein as biomarkers to differentiate ischemic stroke and intracerebral hemorrhage.
26440092 2015 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance.
26425827 2016 Retinol binding protein and vitamin D associations with serum antibody isotypes, serum influenza virus-specific neutralizing activities and airway cytokine profiles.
26178727 2015 High provitamin A carotenoid serum concentrations, elevated retinyl esters, and saturated retinol-binding protein in Zambian preschool children are consistent with the presence of high liver vitamin A stores.
26069091 2016 Short-Term Regulation of Lipocalin-2 but not RBP-4 During Oral Lipid Tolerance Test and Oral Glucose Tolerance Test.
26055327 2015 Transgenic Mice Overexpressing Serum Retinol-Binding Protein Develop Progressive Retinal Degeneration through a Retinoid-Independent Mechanism.
25941915 2015 Retinol binding protein 4 and its membrane receptors: a metabolic perspective.
25910211 2015 Biochemical Basis for Dominant Inheritance, Variable Penetrance, and Maternal Effects in RBP4 Congenital Eye Disease.
25875385 2015 Retinol binding protein 4 induces mitochondrial dysfunction and vascular oxidative damage.
25810022 2015 Retinol binding protein-4 predicts incident diabetes in Asian Indian men with prediabetes.
25712946 2015 Serum levels of retinol-binding protein 4 and risk of colon adenoma.
25703255 2015 Circulating retinol-binding protein 4 levels in gestational diabetes mellitus: a meta-analysis of observational studies.
25701600 2015 Association of RBP4 gene variants with adverse lipid profile and obesity.
25633269 2015 First trimester placental retinol-binding protein 4 (RBP4) and pregnancy-associated placental protein A (PAPP-A) in the prediction of early-onset severe pre-eclampsia.
25479076 2014 A genetic polymorphism in RBP4 is associated with coronary artery disease.
25450816 Possible resting metabolic rate modification by the circulating RBP4 in obese subjects.
25437889 2015 Circulating retinol binding protein 4 is associated with coronary lesion severity of patients with coronary artery disease.
25299197 2014 Decreased retinol-binding protein 4 in the sera of patients with end-stage renal disease after kidney transplantation.
25250314 2014 Proteomics analysis for finding serum markers of ovarian cancer.
25233041 2014 Retinol-binding protein 4 as a novel risk factor for cardiovascular disease in patients with coronary artery disease and hyperinsulinemia.
25227411 2015 Early second trimester retinol-binding protein-4 values in cases with or without gestational diabetes mellitus risk factors: a cross-sectional study.
25142320 2014 Serum levels of retinol-binding protein-4 are associated with the presence and severity of coronary artery disease.
25069671 2014 Association between retinol-binding protein 4 and polycystic ovary syndrome: a meta-analysis.
24956535 2014 The relationship of novel adipokines, RBP4 and omentin-1, with carotid atherosclerosis severity and vulnerability.
24800810 2014 Lower fetuin-A, retinol binding protein 4 and several metabolites after gastric bypass compared to sleeve gastrectomy in patients with type 2 diabetes.
24784414 2014 Serum proteomics of hepatitis C virus infection reveals retinol-binding protein 4 as a novel regulator.
24720534 2014 Retinol-binding protein 4 levels and susceptibility to ischaemic events in men.
24665145 2014 RBP4 gene variants are associated with insulin resistance in women with previous gestational diabetes.
24651174 2014 Retinol binding protein 4 concentrations relate to enhanced atherosclerosis in obese patients with rheumatoid arthritis.
24647386 2014 Elevated plasma retinol-binding protein 4 is associated with increased risk of type 2 diabetes in middle-aged and elderly Chinese adults.
24606904 2014 RBP4 activates antigen-presenting cells, leading to adipose tissue inflammation and systemic insulin resistance.
24593134 2014 Relationship between retinol-binding protein-4/adiponectin and leptin/adiponectin ratios with insulin resistance and inflammation.
24532832 2014 Retinol-binding protein 4 in rheumatoid arthritis-related insulin resistance and ?-cell function.
24397358 2014 Significance of RBP4 in patients with gestational diabetes mellitus: a case-control study of Han Chinese women.
24367155 2013 Associations between tissue visfatin/nicotinamide, phosphoribosyltransferase (Nampt), retinol binding protein-4, and vaspin concentrations and insulin resistance in morbidly obese subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24160775 2013 Serum retinol binding protein 4 is negatively related to beta cell function in Chinese women with non-alcoholic fatty liver disease: a cross-sectional study.
24044566 2013 Serum adiponectin, leptin, resistin and RBP4 levels in obese and metabolic syndrome children with nonalcoholic fatty liver disease.
24011638 2013 Long-term impact of vertical banded gastroplasty (VBG) on plasma concentration of leptin, soluble leptin receptor, ghrelin, omentin-1, obestatin, and retinol binding protein 4 (RBP4) in patients with severe obesity.
23979787 2014 The effects of weight loss on FABP4 and RBP4 in obese women with metabolic syndrome.
23799122 2013 Circulating lipocalin-2 and retinol-binding protein 4 are associated with intima-media thickness and subclinical atherosclerosis in patients with type 2 diabetes.
23764679 2014 Retinol-binding protein 4 and insulin resistance are related to body fat in primary and secondary schoolchildren: the Ouro Preto study.
23734806 2013 Relationship of adipokines (adiponectin, resistin and RBP4) with metabolic syndrome components in pubertal obese children.
23708710 2013 Induction of retinol-binding protein 4 and placenta-specific 8 expression in human prostate cancer cells remaining in bone following osteolytic tumor growth inhibition by osteoprotegerin.
23584360 2013 Plasma retinol-binding protein 4 (RBP4) levels and risk of coronary heart disease: a prospective analysis among women in the nurses' health study.
23571154 2013 Kisspeptin, leptin, and retinol-binding protein 4 in women with polycystic ovary syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23480783 2013 Free fatty acid binding protein-4 and retinol binding protein-4 in polycystic ovary syndrome: response to simvastatin and metformin therapies.
23460908 2013 Interleukin-1? downregulates RBP4 secretion in human adipocytes.
23420326 2013 Retinol-binding protein 4 as a risk factor for cholesterol gallstone formation.
23418565 2013 Transcriptional patterns in peritoneal tissue of encapsulating peritoneal sclerosis, a complication of chronic peritoneal dialysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23350588 2013 Retinol binding protein as early marker of fetal growth restriction in first trimester maternal serum.
23242471 2013 Circulating levels of lipocalin-2 and retinol-binding protein-4 are increased in psoriatic patients and correlated with baseline PASI.
23189188 2012 Exome analysis identified a novel mutation in the RBP4 gene in a consanguineous pedigree with retinal dystrophy and developmental abnormalities.
23153527 2013 Association of retinol binding protein 4 with risk of gestational diabetes.
23145084 2012 Effects of PPAR? and RBP4 gene variants on metabolic syndrome in HIV-infected patients with anti-retroviral therapy.
23129325 2012 Contrasting effects of type 2 and type 1 diabetes on plasma RBP4 levels: the significance of transthyretin.
23119072 2012 Serum retinol-binding protein 4 as a marker for cardiovascular disease in women.
23105095 2013 Liver retinol transporter and receptor for serum retinol-binding protein (RBP4).
23087360 2012 Retinol-binding protein 4 is an independent factor associated with triglycerides and a determinant of very low-density lipoprotein-apolipoprotein B100 catabolism in type 2 diabetes mellitus.
23074124 2012 Serum retinol-binding protein-4 levels are increased in HIV-infected subjects with metabolic syndrome receiving highly active antiretroviral therapy.
23073835 2012 The RNA Pol II sub-complex hsRpb4/7 is required for viability of multiple human cell lines.
23071093 2012 Retinol-binding protein 4 induces inflammation in human endothelial cells by an NADPH oxidase- and nuclear factor kappa B-dependent and retinol-independent mechanism.
23020231 2012 Serum retinol binding protein-4 and neutrophil gelatinase-associated lipocalin are interrelated in pancreatic cancer patients.
22971483 2012 Higher serum retinol binding protein 4 may be a predictor of weak metabolic control in chinese patients with type 2 diabetes mellitus.
22878527 2013 Retinol-binding protein 4 downregulation during osteogenesis and its localization to non-endocytic vesicles in human cranial suture mesenchymal cells suggest a novel tissue function.
22863748 2012 Prompt increases in retinol-binding protein 4 and endothelial progenitor cells during acute exercise load in diabetic subjects.
22855337 2012 Cardiometabolic correlates and heritability of fetuin-A, retinol-binding protein 4, and fatty-acid binding protein 4 in the Framingham Heart Study.
22826435 2012 Transthyretin blocks retinol uptake and cell signaling by the holo-retinol-binding protein receptor STRA6.
22800884 2012 Cigarette smoking increases levels of retinol-binding protein-4 in healthy men with normal glucose tolerance.
22785609 2012 Increased levels of retinol binding protein 4 in patients with advanced heart failure correct after hemodynamic improvement through ventricular assist device placement.
22685600 2012 Circulating levels of adiponectin, leptin, fetuin-A and retinol-binding protein in patients with tuberculosis: markers of metabolism and inflammation.
22491740 2012 Induction of insulin resistance by the adipokines resistin, leptin, plasminogen activator inhibitor-1 and retinol binding protein 4 in human megakaryocytes.
22426023 2012 Association among retinol-binding protein 4, small dense LDL cholesterol and oxidized LDL levels in dyslipidemia subjects.
22397743 2012 Are plasma levels of visfatin and retinol-binding protein 4 (RBP4) associated with body mass, metabolic and hormonal disturbances in women with polycystic ovary syndrome?
22308842 2011 Retinol binding protein 4 is associated with adiposity-related co-morbidity risk factors in children.
22308028 2012 Increased unbound retinol-binding protein 4 concentration induces apoptosis through receptor-mediated signaling.
22253430 2012 Quantitative measurement of full-length and C-terminal proteolyzed RBP4 in serum of normal and insulin-resistant humans using a novel mass spectrometry immunoassay.
22205567 2012 The metabolic role of retinol binding protein 4: an update.
22151390 2012 Leptin, adiponectin, visfatin and retinol-binding protein-4 - mediators of comorbidities in patients with psoriasis?
22086013 2011 Impact of retinol binding protein 4 polymorphism on rosiglitazone response in Chinese type 2 diabetic patients.
22068556 2011 The promoter variant -803?G>A in the RBP4 gene is not associated with BMI, metabolic parameters or blood pressure in Caucasian children.
22023042 2012 The relationship between retinol-binding protein 4 levels, insulin resistance, androgen hormones and polycystic ovary syndrome.
22020625 2012 Decreased concentrations of retinol-binding protein 4 in sera of epithelial ovarian cancer patients: a potential biomarker identified by proteomics.
21939650 2011 Plasma visfatin and retinol binding protein-4 levels in patients with type 2 diabetes mellitus and their relationship to adiposity and fatty liver.
21886308 2011 A polymorphism in the retinol binding protein 4 gene is not associated with gestational diabetes mellitus in several different ethnic groups.
21878437 2011 Genome-wide association study of circulating retinol levels.
21835764 2011 RBP4: a controversial adipokine.
21821833 2012 Estimated glomerular filtration rate and its association with the retinol-binding protein 4 (RBP4) locus on human chromosome 10q23.
21817822 2011 Elevated serum retinol-binding protein 4 concentrations are associated with chronic kidney disease but not with the higher carotid intima-media thickness in type 2 diabetic subjects.
21777382 2011 Effect of the N-terminal sequence on the binding affinity of transthyretin for human retinol-binding protein.
21741059 2012 Retinol-binding protein 4 is not associated with insulin resistance in pregnancy.
21655067 2011 Association of serum retinol binding protein 4 with adiposity and pubertal development in Korean children and adolescents.
21645024 2012 Coronary artery disease is associated with higher epicardial retinol-binding protein 4 (RBP4) and lower glucose transporter (GLUT) 4 levels in epicardial and subcutaneous adipose tissue.
21617096 2011 Retinol-binding protein 4 is associated with prediabetes in adults from the general population: the Cooperative Health Research in the Region of Augsburg (KORA) F4 Study.
21609194 2011 Retinol-binding protein 4 in adipose and placental tissue of women with gestational diabetes.
21600576 2011 Serum retinol-binding protein 4, leptin, and plasma asymmetric dimethylarginine levels in obese and nonobese young women with polycystic ovary syndrome.
21458418 2011 Effects of retinol binding protein-4 on vascular endothelial cells.
21406189 2011 Circulating Nampt and RBP4 levels in patients with carotid stenosis undergoing carotid endarterectomy (CEA).
21383997 2011 Retinol binding protein-4 as a serum biomarker of intrahepatic lipid content in obese children--preliminary report.
21299359 2011 Retinol-binding protein-4 is decreased in patients with preeclampsia in comparison with normal pregnant women.
21269460 2011 Initial characterization of the human central proteome.
21223811 2010 [Depot-specific expression of retinol-binding protein 4 in human adipose tissue and their relationship with obesity and insulin resistance].
21176857 2011 The relationship between adipocyte fatty acid binding protein-4, retinol binding protein-4 levels and early diabetic nephropathy in patients with type 2 diabetes.
21173508 2011 Retinol-binding protein 4 and insulin resistance in preeclampsia.
21164503 2011 Retinol-binding protein 4 in young men with low versus normal birth weight: physiological response to short-term overfeeding.
21106915 2011 Serum adipocyte fatty acid-binding protein, retinol-binding protein 4, and adiponectin concentrations in relation to the development of the metabolic syndrome in Korean boys: a 3-y prospective cohort study.
21104585 2011 The lipocalins retinol-binding protein-4, lipocalin-2 and lipocalin-type prostaglandin D2-synthase correlate with markers of inflammatory activity, alcohol intake and blood lipids, but not with insulin sensitivity in metabolically healthy 58-year-old Swedish men.
21085476 2010 Adipokine pattern in subjects with impaired fasting glucose and impaired glucose tolerance in comparison to normal glucose tolerance and diabetes.
21039728 2011 Human RBP4 adipose tissue expression is gender specific and influenced by leptin.
20950077 2011 Retinol binding protein 4 (RBP4) is primarily associated with adipose tissue mass in children.
20932285 2010 Circulating retinol binding protein 4 in critically ill patients before specific treatment: prognostic impact and correlation with organ function, metabolism and inflammation.
20929509 2009 Serum retinol-binding protein 4 is associated with insulin secretion in Chinese people with normal glucose tolerance.
20849357 2010 Erythrocyte sodium-lithium countertransport activity is inversely correlated to adiponectin, retinol binding protein 4 and body height.
20819415 Resistance exercise did not alter intramuscular adipose tissue but reduced retinol-binding protein-4 concentration in individuals with type 2 diabetes mellitus.
20798476 2010 Associations of metabolic factors, especially serum retinol-binding protein 4 (RBP4), with blood pressure in Japanese--the Tanno and Sobetsu study.
20646597 2010 [Expression and regulation of retinol binding protein 4 mRNA in human adipose tissue in obese and type 2 diabetics].
20625434 2010 Case-control analysis of SNPs in GLUT4, RBP4 and STRA6: association of SNPs in STRA6 with type 2 diabetes in a South Indian population.
20610143 2010 Decreased retinol binding protein 4 concentrations are associated with cholesterol gallstone disease.
20503483 2010 Retinol-binding protein 4 in neonates born small for gestational age.
20436266 2010 Serum retinol binding protein 4 level is related with renal functions in Type 2 diabetes.
20389103 2010 Retinol-binding protein 4 levels in obese children and adolescents with glucose intolerance.
20376890 2010 Association of plasma retinol-binding protein 4, adiponectin, and high molecular weight adiponectin with insulin resistance in non-diabetic hypertensive patients.
20233518 Serum retinol-binding protein 4 levels in patients with diabetic retinopathy.
20224248 2010 Reduction of serum retinol-binding protein-4 levels in nondiabetic obstructive sleep apnea patients under continuous positive airway pressure treatment.
20146659 2010 Retinol-binding protein 4: a novel adipokine implicated in the genesis of LGA in the absence of gestational diabetes mellitus.
20097162 2010 Alterations of retinol-binding protein 4 species in patients with different stages of chronic kidney disease and their relation to lipid parameters.
20058618 2009 [Serum levels of retinol-binding protein-4 and its association with metabolic syndrome in first-degree relatives of type 2 diabetes mellitus].
19949653 2009 Clinical implications of serum retinol-binding protein 4 in asthmatic children.
19900011 2010 Retinol binding protein 4: an adipokine associated with intra-amniotic infection/inflammation.
19897788 2010 Association between retinol-binding protein 4 concentrations and gestational diabetes mellitus and risk of developing metabolic syndrome after pregnancy.
19893506 2010 Association of RBP4 gene variants and serum HDL cholesterol levels in the Newfoundland population.
19875582 2009 Adipocytokines and insulin resistance: the possible role of lipocalin-2, retinol binding protein-4, and adiponectin.
19857477 2010 Serum retinol-binding protein 4 (RBP4) and retinol in a cohort of borderline obese women with and without gestational diabetes.
19851303 2010 Regulatory SNP in the RBP4 gene modified the expression in adipocytes and associated with BMI.
19820404 2010 Serum retinol-binding protein 4 in patients with nonalcoholic fatty liver disease: does it have a significant impact on pathogenesis?
19794289 2009 Variations of retinol binding protein 4 levels are not associated with changes in insulin resistance during puberty.
19766271 2010 Elevated serum retinol-binding protein 4 is associated with insulin resistance in older women.
19765959 2010 The APOA5-1131 T>C variant enhances the association between RBP4 and hypertriglyceridemia in diabetes.
19709697 2009 Levels of retinol-binding protein 4 and uric acid in patients with type 2 diabetes mellitus.
19708829 2010 Retinol binding protein 4--a novel association with early-onset preeclampsia.
19671994 2009 Serum retinol-binding protein 4 is elevated and positively associated with insulin resistance in postmenopausal women.
19589139 2009 Adiponectin, retinol-binding protein 4, and leptin in protracted critical illness of pulmonary origin.
19573524 2009 Alterations in serum adipocyte fatty acid binding protein and retinol binding protein-4 in normal pregnancy and preeclampsia.
19556974 2009 Retinol-binding protein-4 in women with untreated essential hypertension.
19537932 2010 Macrophages are novel sites of expression and regulation of retinol binding protein-4 (RBP4).
19525859 Serum retinol-binding protein 4 levels in patients with nonalcoholic fatty liver disease.
19506831 2009 Retinol-binding protein 4 is associated with impaired glucose regulation and microalbuminuria in a Chinese population.
19501863 2009 Serum retinol-binding protein 4 correlates with obesity, insulin resistance, and dyslipidemia in HIV-infected subjects receiving highly active antiretroviral therapy.
19501859 2009 Factors that influence retinol-binding protein 4-transthyretin interaction are not altered in overweight subjects and overweight subjects with type 2 diabetes mellitus.
19403191 2009 Relationship between serum retinol-binding protein 4 and visfatin and the metabolic syndrome.
19369430 2009 Parallel downregulation of retinol-binding protein-4 and adiponectin expression in subcutaneous adipose tissue of non-morbidly obese subjects.
19346786 2009 [The value of serum retinol-binding protein 4 levels for determining disease severity in patients with chronic liver disease].
19339013 2009 Circulating retinol-binding protein 4, cardiovascular risk factors and prevalent cardiovascular disease in elderly.
19303000 2009 Serum retinol binding protein 4 in patients with familial partial lipodystrophy.
19288010 2009 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19287041 2009 RBP4 variants are significantly associated with plasma RBP4 levels and hypertriglyceridemia risk in Chinese Hans.
19224430 2009 Changes in insulin resistance and cardiovascular risk induced by PPARgamma activation have no impact on RBP4 plasma concentrations in nondiabetic patients.
19217438 2009 Preliminary report: Serum levels of retinol-binding protein 4 in preeclampsia.
19195734 2009 Serum retinal-binding protein 4 is positively related to insulin resistance in Chinese subjects with type 2 diabetes.
19190263 2009 Retinol-binding protein 4 is associated with impaired glucose tolerance but not with whole body or hepatic insulin resistance in Mexican Americans.
19169049 2008 Low free plasma levels of retinol-binding protein 4 in insulin-resistant subjects with polycystic ovary syndrome.
19158194 2009 Retinol-binding protein 4 in polycystic ovary syndrome--association with steroid hormones and response to pioglitazone treatment.
19155083 2009 Serum retinol-binding protein 4 is inversely correlated with disease severity of chronic hepatitis C.
19147488 2009 Identification and characterization of a non-retinoid ligand for retinol-binding protein 4 which lowers serum retinol-binding protein 4 levels in vivo.
19122345 2009 An increase in serum retinol-binding protein 4 in the type 2 diabetic subjects with nephropathy.
19114616 2009 Circulating retinol-binding protein 4 and subclinical cardiovascular disease in the elderly.
19088257 2009 Fenofibrate reduces serum retinol-binding protein-4 by suppressing its expression in adipose tissue.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19053019 2009 Human fetal adiponectin and retinol-binding protein (RBP)-4 levels in relation to birth weight and maternal obesity.
19046959 2009 Effect of renal replacement therapy on retinol-binding protein 4 isoforms.
19023195 2009 Serum retinol-binding protein concentration and its association with components of the uremic metabolic syndrome in nondiabetic patients with chronic kidney disease stage 5.
19021760 2008 Structural and mutational analyses of protein-protein interactions between transthyretin and retinol-binding protein.
19003725 2009 Visceral obesity is associated with the metabolic syndrome and elevated plasma retinol binding protein-4 level in obstructive sleep apnea syndrome.
18980783 2008 Effects of trans10cis12CLA-induced insulin resistance on retinol-binding protein 4 concentrations in abdominally obese men.
18977339 2009 Retinol binding protein 4 and insulin resistance in apparently healthy elderly subjects.
18973209 Elevated serum retinol-binding protein 4 concentrations are associated with renal dysfunction and uric acid in type 2 diabetic patients.
18937078 Evaluation of the association between retinal binding protein 4 polymorphisms and type 2 diabetes in Chinese by DHPLC.
18854400 2009 Retinol-binding protein 4 and prediction of incident coronary events in healthy men and women.
18852328 2009 Retinol-binding protein 4 in twins: regulatory mechanisms and impact of circulating and tissue expression levels on insulin secretion and action.
18838136 2009 Retinol-binding protein-4 is associated with endothelial dysfunction in adults with newly diagnosed type 2 diabetes mellitus.
18796616 2008 Evidence that kidney function but not type 2 diabetes determines retinol-binding protein 4 serum levels.
18783798 2009 The relationship of retinol binding protein 4 to changes in insulin resistance and cardiometabolic risk in overweight black adolescents.
18782570 2009 Association between serum retinol-binding protein 4 and small dense low-density lipoprotein cholesterol levels in young adult women.
18752671 2008 Isoforms of retinol binding protein 4 (RBP4) are increased in chronic diseases of the kidney but not of the liver.
18719670 2008 Retinol-binding protein 4, visceral fat, and the metabolic syndrome: effects of weight loss.
18710473 2009 Effect of exercise training on A-FABP, lipocalin-2 and RBP4 levels in obese women.
18641048 2008 Retinol to retinol-binding protein (RBP) is low in obese adults due to elevated apo-RBP.
18588869 2008 Plasma retinol-binding protein is not a marker of insulin resistance in overweight subjects: a three year longitudinal study.
18506842 2008 Retinol-binding protein 4: a new marker of virus-induced steatosis in patients infected with hepatitis c virus genotype 1.
18496666 2008 An RBP4 promoter polymorphism increases risk of type 2 diabetes.
18493106 2008 Abdominal visceral fat reduction is associated with favorable changes of serum retinol binding protein-4 in nondiabetic subjects.
18492757 2008 High plasma retinol binding protein-4 and low plasma adiponectin concentrations are associated with severity of glucose intolerance in women with previous gestational diabetes mellitus.
18466349 2009 Decreased hepatic RBP4 secretion is correlated with reduced hepatic glucose production but is not associated with insulin resistance in patients with liver cirrhosis.
18445670 2008 Serum levels of retinol-binding protein 4 and adiponectin in women with polycystic ovary syndrome: associations with visceral fat but no evidence for fat mass-independent effects on pathogenesis in this condition.
18437353 2008 Serum concentrations of retinol-binding protein 4 in women with and without gestational diabetes.
18426863 2008 Circulating retinol-binding protein-4 concentration might reflect insulin resistance-associated iron overload.
18426837 2008 Retinol, retinol-binding protein 4, abdominal fat mass, peak bone mineral density, and markers of bone metabolism in men: the Northern Osteoporosis and Obesity (NO2) Study.
18426814 2008 Retinol-binding protein-4 is not strongly associated with insulin sensitivity in normal pregnancies.
18397979 2008 Retinol-binding protein 4 and its relation to insulin resistance in obese children before and after weight loss.
18390799 2008 Retinol-binding protein 4 and insulin resistance in polycystic ovary syndrome.
18381580 2008 Retinol binding protein-4 elevation is associated with serum thyroid-stimulating hormone level independently of obesity in elderly subjects with normal glucose tolerance.
18316031 2008 RBP4 disrupts vitamin A uptake homeostasis in a STRA6-deficient animal model for Matthew-Wood syndrome.
18239568 2008 Influence of age on the association of retinol-binding protein 4 with metabolic syndrome.
18199128 2008 Effect of RBP4 gene variants on circulating RBP4 concentration and type 2 diabetes in a Chinese population.
18081728 2008 Serum retinol-binding protein 4 is not increased in obesity or obesity-associated type 2 diabetes mellitus, but is reduced after relevant reductions in body fat following gastric bypass.
18052678 2008 Retinol-binding protein 4 expression in visceral and subcutaneous fat in human obesity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17957146 2007 High-normal C-reactive protein levels do not affect the vitamin A transport complex in serum of children and adolescents with type 1 diabetes.
17904683 2008 Serum retinol binding protein 4 and nonalcoholic fatty liver disease in patients with type 2 diabetes mellitus.
17890490 2007 Visceral adiposity is associated with serum retinol binding protein-4 levels in healthy women.
17728376 2007 Effects of genetic variation in the human retinol binding protein-4 gene (RBP4) on insulin resistance and fat depot-specific mRNA expression.
17686833 2007 Effect of weight loss on LDL and HDL kinetics in the metabolic syndrome: associations with changes in plasma retinol-binding protein-4 and adiponectin levels.
17661007 2007 Regulation of retinol binding protein 4 production in primary human adipocytes by adiponectin, troglitazone and TNF-alpha.
17639305 2007 Retinol-binding protein 4 is associated with components of the metabolic syndrome, but not with insulin resistance, in men with type 2 diabetes or coronary artery disease.
17630267 2007 Serum levels of adipokine retinol-binding protein-4 in relation to renal function.
17618858 2007 Serum retinol-binding protein is more highly expressed in visceral than in subcutaneous adipose tissue and is a marker of intra-abdominal fat mass.
17595259 2007 Retinol binding protein 4 expression in humans: relationship to insulin resistance, inflammation, and response to pioglitazone.
17575262 2007 Retinol-binding protein-4 attenuates insulin-induced phosphorylation of IRS1 and ERK1/2 in primary human adipocytes.
17568782 2007 Microalbuminuria is a major determinant of elevated plasma retinol-binding protein 4 in type 2 diabetic patients.
17550959 2007 Association of serum retinol-binding protein 4 and visceral adiposity in Chinese subjects with and without type 2 diabetes.
17526940 2006 Elevated serum RBP4 is associated with insulin resistance in women with polycystic ovary syndrome.
17456573 2007 Raised serum, adipocyte, and adipose tissue retinol-binding protein 4 in overweight women with polycystic ovary syndrome: effects of gonadal and adrenal steroids.
17405846 2007 Plasma levels and adipose tissue messenger ribonucleic acid expression of retinol-binding protein 4 are reduced during calorie restriction in obese subjects but are not related to diet-induced changes in insulin sensitivity.
17337499 2007 Insulin resistance in liver cirrhosis is not associated with circulating retinol-binding protein 4.
17299074 2007 Retinol-binding protein 4 is associated with insulin resistance and body fat distribution in nonobese subjects without type 2 diabetes.
17259477 2007 High circulating retinol-binding protein 4 is associated with elevated liver fat but not with total, subcutaneous, visceral, or intramyocellular fat in humans.
17174134 2007 Retinol binding protein 4 as a candidate gene for type 2 diabetes and prediabetic intermediate traits.
17164313 2007 Serum retinol-binding protein 4 is reduced after weight loss in morbidly obese subjects.
17065684 2006 Plasma retinol-binding protein-4 concentrations are elevated in human subjects with impaired glucose tolerance and type 2 diabetes.
17006670 2007 Identification of a regulatory SNP in the retinol binding protein 4 gene associated with type 2 diabetes in Mongolia.
17003346 2006 Retinol-binding protein 4 in human obesity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16156801 2005 Characterization of the molten globule state of retinol-binding protein using a molecular dynamics simulation approach.
16034410 2005 Serum retinol binding protein 4 contributes to insulin resistance in obesity and type 2 diabetes.
15649951 2005 Susceptibility and modifier genes in Portuguese transthyretin V30M amyloid polyneuropathy: complexity in a single-gene disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12716133 Comparative urine protein phenotyping using mass spectrometric immunoassay.
12593674 2003 A new method for purification of human plasma retinol-binding protein and transthyretin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237133 2002 Comparative phenotypic analyses of human plasma and urinary retinol binding protein using mass spectrometric immunoassay.
12228058 2002 Crocodile transthyretin: structure, function, and evolution.
11853533 2002 The transfer of transthyretin and receptor-binding properties from the plasma retinol-binding protein to the epididymal retinoic acid-binding protein.
11058747 2000 Plasma retinol binding protein: structure and function of the prototypic lipocalin.
10944490 2000 Retinol and retinol-binding protein: gut integrity and circulating immunoglobulins.
10232633 1999 Biochemical but not clinical vitamin A deficiency results from mutations in the gene for retinol binding protein.
10052934 1999 The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.
9888420 1999 Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.
8089102 1994 The Ile-84-->Ser amino acid substitution in transthyretin interferes with the interaction with plasma retinol-binding protein.
7666002 1995 Characterization of two post-translationally processed forms of human serum retinol-binding protein: altered ratios in chronic renal failure.
6942701 1981 Structural and functional studies of vitamin A-binding proteins.
6540172 1984 The three-dimensional structure of retinol-binding protein.
6316270 1983 Cloning and sequencing of a full length cDNA coding for human retinol-binding protein.
5132677 1971 Studies on two physiological forms of the human retinol-binding protein differing in vitamin A and arginine content.
3559267 1987 Loss of retinol-binding properties for plasma retinol-binding protein in normal human epidermis.
3525470 1986 Immunohistochemical localization of plasma retinol-binding protein and prealbumin in human pancreatic islets.
3013795 1986 Membrane receptors for retinol-binding protein in cultured human retinal pigment epithelium.
2998779 1985 Structure and cell-specific expression of a cloned human retinol binding protein gene: the 5'-flanking region contains hepatoma specific transcriptional signals.
2928844 1989 Regional mapping of RBP4 to 10q23----q24 and RBP1 to 3q21----q22 in man.
2444024 1987 The complete amino acid sequence of human serum retinol-binding protein.
2217163 1990 Crystallographic refinement of human serum retinol binding protein at 2A resolution.
1623143 1992 Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity.
986177 1976 The interaction between retinol-binding proteins and prealbumins studied by fluorescence polarization.
574085 1979 Interaction between prealbumin and retinol-binding protein studied by affinity chromatography, gel filtration and two-phase partition.
573217 1979 The primary structure of the human retinol-binding protein.
571335 1979 Retinol-binding protein from human urine and its interaction with retinol and prealbumin.