Property Summary

NCBI Gene PubMed Count 10
PubMed Score 31.61
PubTator Score 16.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.400 3.8e-15
ductal carcinoma in situ -1.300 1.1e-04
invasive ductal carcinoma -2.100 3.0e-04
lung adenocarcinoma -1.200 5.6e-16
lung carcinoma -1.900 4.6e-26
non-small cell lung cancer -1.688 1.2e-18
ovarian cancer -1.900 3.9e-08
spina bifida -1.804 4.1e-02

Synonym

Accession Q15434
Symbols SCR3

Gene

PDB

1X4E  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYIRGLQPGTTDQ      1 - 70
DLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYIS     71 - 140
NLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPS    141 - 210
DPLLCKFADGGPKKRQNQGKFVQNGRAWPRNADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALS    211 - 280
PYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLS    281 - 350
STGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK                 351 - 407
//

Text Mined References (18)

PMID Year Title