Tbio | RNA-binding motif, single-stranded-interacting protein 1 |
Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.
This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009]
This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009]
Comments
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2843 | 4.2e-30 |
glioblastoma multiforme | 142 | 1.9e-15 |
juvenile dermatomyositis | 1187 | 8.0e-12 |
Breast cancer | 3578 | 1.9e-09 |
Astrocytoma, Pilocytic | 3081 | 1.2e-06 |
ulcerative colitis | 1819 | 3.7e-06 |
acute quadriplegic myopathy | 1158 | 7.7e-05 |
Pick disease | 1894 | 8.8e-05 |
pancreatic cancer | 2398 | 1.8e-04 |
invasive ductal carcinoma | 2951 | 1.5e-03 |
atypical teratoid / rhabdoid tumor | 5112 | 2.5e-03 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 3.9e-03 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 5.9e-03 |
gastric carcinoma | 807 | 6.8e-03 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.1e-02 |
subependymal giant cell astrocytoma | 2287 | 2.5e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Amyotrophic lateral sclerosis | 451 | 0.0 | 0.7 |
Type 2 diabetes mellitus | 272 | 0.0 | 1.3 |
Disease | log2 FC | p |
---|---|---|
acute quadriplegic myopathy | 1.276 | 7.7e-05 |
Astrocytoma, Pilocytic | 1.400 | 1.2e-06 |
atypical teratoid / rhabdoid tumor | 1.400 | 2.5e-03 |
autosomal dominant Emery-Dreifuss muscul... | 1.075 | 3.9e-03 |
Breast cancer | -1.500 | 1.9e-09 |
gastric carcinoma | 1.100 | 6.8e-03 |
glioblastoma multiforme | 1.300 | 1.9e-15 |
intraductal papillary-mucinous carcinoma... | -1.500 | 2.1e-02 |
invasive ductal carcinoma | -1.400 | 1.5e-03 |
juvenile dermatomyositis | 1.480 | 8.0e-12 |
lung carcinoma | -2.400 | 4.2e-30 |
pancreatic cancer | 3.300 | 1.8e-04 |
pancreatic ductal adenocarcinoma liver m... | 1.288 | 5.9e-03 |
Pick disease | 1.200 | 8.8e-05 |
subependymal giant cell astrocytoma | 2.211 | 2.5e-02 |
ulcerative colitis | 2.400 | 3.7e-06 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG |
MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP 1 - 70 PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP 71 - 140 TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP 141 - 210 GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATN 211 - 280 RMITQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLG 281 - 350 STGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK 351 - 406 //