Property Summary

NCBI Gene PubMed Count 33
PubMed Score 47.53
PubTator Score 84.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 IMPC Phenotype (1)

Gene RIF (17)

PMID Text
26506517 Loss of RBM4 expression is associated with colorectal cancer.
25414336 The results indicate that the alanine-rich C-terminal domain, in conjunction with its conjoined RNA-binding domain(s), differentially influences the subnuclear localization and biogenesis of RBM4.
25203323 RBM4 is a tumor suppressor with therapeutic potential and clinical values as a prognostic factor.
25140042 Up-regulation of RBM4 is associated with breast cancer.
24389249 we propose the emerging role of RBM4 in regulating the adipocyte-specific splicing events and transcription cascade, which subsequently facilitate the development and function of brown adipocyte-like cells.
23897118 role in negative feed-forward loop that disrupts inflammattory cytokine translation following Toll-like receptor 4 response
23527094 RBM4 homologs exert different effects on 5' splice site utilization and exon selection, and exhibit different subnuclear localization patterns.
21518792 RBM4 may synergize its effect on muscle cell-specific alternative splicing by down-regulating PTB expression and antagonizing the activity of PTB in exon selection
19801630 Data show that RBM4 interacts directly with Ago2 during muscle cell differentiation and may recruit Ago2 to suppress translation of target mRNAs.
19416963 The alternative splicing imbalance of CoAA and RBM4, because of loss of their common enhancer in cancer, may deregulate stem/progenitor cell differentiation
18723113 RBM4 is an RNA-binding protein involved in diverse cellular processes that include alternative splicing of pre-mRNA, translation, and RNA silencing.
18708123 human brain, expression of RBM4a was strongly up-regulated in cerebellum as compared to forebrain.
17284590 a previously unrecognized paradigm for the RNA-binding protein RBM4 in its phosphorylation-modulated dual action as a suppressor of cap-dependent and enhancer of IRES-mediated translation in response to stress signals
16934801 Wilms tumor 1 protein, WT1 interacts with the novel splicing regulator RBM4, the longer isoform of WT1 is able to inhibit the effect of RBM4 on alternative splicing.
16777844 RBM4 is expressed in the human brain regions affected in tauopathy, including the hippocampus and frontal cortex. RBM4 is involved in tau exon 10 alternative splicing
16260624 the regulated alternative splicing of alpha-TM by the antagonistic splicing regulators RBM4 and PTB
12469345 Data show that the nuclear matrix protein matrin 3, cytoskeletal motor protein HMP, and the circadian clock protein lark were significantly decreased in fetal Down syndrome brain.

AA Sequence

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS      1 - 70
KNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR     71 - 140
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLY    141 - 210
YNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTS    211 - 280
GAAATAAAAAAAAAAVTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARY    281 - 350
EREQYADRARYSAF                                                            351 - 364
//

Text Mined References (43)

PMID Year Title
26506517 2015 The impact of RNA binding motif protein 4-regulated splicing cascade on the progression and metabolism of colorectal cancer cells.
25414336 2014 Alanine repeats influence protein localization in splicing speckles and paraspeckles.
25203323 2014 The splicing factor RBM4 controls apoptosis, proliferation, and migration to suppress tumor progression.
25140042 2014 Elevated SRPK1 lessens apoptosis in breast cancer cells through RBM4-regulated splicing events.
24389249 2014 Emerging role for RNA binding motif protein 4 in the development of brown adipocytes.
23897118 2013 MicroRNA-146a and RBM4 form a negative feed-forward loop that disrupts cytokine mRNA translation following TLR4 responses in human THP-1 monocytes.
23527094 2013 Phylogenetic and molecular characterization of the splicing factor RBM4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21518792 2011 RBM4 down-regulates PTB and antagonizes its activity in muscle cell-specific alternative splicing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21343338 2011 RNA helicase p68 (DDX5) regulates tau exon 10 splicing by modulating a stem-loop structure at the 5' splice site.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19801630 2009 RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation.
19561594 2009 Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins.
19416963 2009 Functional pre- mRNA trans-splicing of coactivator CoAA and corepressor RBM4 during stem/progenitor cell differentiation.
18723113 2009 RBM4: a multifunctional RNA-binding protein.
18708123 2008 The LARK/RBM4a protein is highly expressed in cerebellum as compared to cerebrum.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17284590 2007 Cell stress modulates the function of splicing regulatory protein RBM4 in translation control.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16934801 2006 WT1 interacts with the splicing protein RBM4 and regulates its ability to modulate alternative splicing in vivo.
16907643 2006 Lark is the splicing factor RBM4 and exhibits unique subnuclear localization properties.
16777844 2006 RBM4 interacts with an intronic element and stimulates tau exon 10 inclusion.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260624 2005 Exon selection in alpha-tropomyosin mRNA is regulated by the antagonistic action of RBM4 and PTB.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12628928 2003 A novel splicing regulator shares a nuclear import pathway with SR proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469345 2002 Manifold decreased protein levels of matrin 3, reduced motor protein HMP and hlark in fetal Down's syndrome brain.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9169144 1997 A novel zinc finger-containing RNA-binding protein conserved from fruitflies to humans.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.