Property Summary

NCBI Gene PubMed Count 18
PubMed Score 21.07
PubTator Score 48.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 1.300 4.6e-02
acute quadriplegic myopathy 1.102 5.2e-07
Alzheimer's disease -1.200 4.0e-02
astrocytoma 1.200 2.4e-02
Breast cancer -1.100 1.3e-07
dermatomyositis 1.400 5.2e-04
ependymoma 1.700 2.2e-02
glioblastoma 1.100 7.3e-03
group 3 medulloblastoma 1.300 9.1e-03
intraductal papillary-mucinous adenoma (... 1.100 2.6e-03
intraductal papillary-mucinous carcinoma... 1.400 4.4e-03
juvenile dermatomyositis 1.285 3.8e-08
lung adenocarcinoma 1.065 5.5e-05
oligodendroglioma 1.400 4.4e-02
ovarian cancer -1.500 6.3e-07
pancreatic cancer -1.200 1.9e-03
pancreatic carcinoma -1.200 1.9e-03
pancreatic ductal adenocarcinoma liver m... 1.252 2.3e-03
Pick disease -1.200 6.5e-04
primitive neuroectodermal tumor 1.200 3.2e-03
progressive supranuclear palsy -1.500 6.5e-03
Rheumatoid arthritis 1.100 3.5e-02
Waldenstrons macroglobulinemia 1.227 7.8e-03

Gene RIF (6)

AA Sequence

MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKD      1 - 70
HPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPEST     71 - 140
LRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASNGNARPETVTNDDEEALDEETKRRDQMIKGA    141 - 210
IEVLIREYSSELNAPSQESDSHPRKKKKEKKEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISRE    211 - 280
ISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRD    281 - 350
RDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERE    351 - 420
REREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMA    421 - 490
KEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDA    491 - 560
ELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEPMEEEEEPEQKPCLKPTLRPISSAPSVSSAS    561 - 630
GNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFED    631 - 700
EDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERR    701 - 770
IRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIG    771 - 840
LVK                                                                       841 - 843
//

Text Mined References (31)

PMID Year Title