Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.24
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.300 2.7e-03
Astrocytoma, Pilocytic -2.200 2.5e-04
chronic rhinosinusitis -1.520 2.8e-02
cystic fibrosis -1.579 3.0e-05
glioblastoma -1.600 3.9e-03
group 4 medulloblastoma 2.700 1.1e-03
interstitial cystitis -2.000 4.8e-03
medulloblastoma, large-cell -1.800 2.8e-02
nasopharyngeal carcinoma -2.100 7.4e-06
oligodendroglioma -1.800 4.7e-02
ovarian cancer 1.400 4.6e-03
pediatric high grade glioma -1.400 3.8e-02
pituitary cancer -1.800 5.9e-04
posterior fossa group B ependymoma 1.300 5.9e-03
subependymal giant cell astrocytoma 3.213 2.6e-02

Synonym

Accession Q9BX46 E9PAY4 Q6QDA4 Q8N9D3 Q96NI3
Symbols RNPC6
dJ259A10.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACK      1 - 70
DPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPT     71 - 140
AAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAA    141 - 210
AAAAAAAAAAAFGQYQPQQLQTDRMQ                                                211 - 236
//

Text Mined References (15)

PMID Year Title