Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.13
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1614 1.2e-02
Multiple Sclerosis 498 4.3e-02

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.600 1.2e-02
Multiple Sclerosis 1.300 4.3e-02

Gene RIF (10)

PMID Text
23390309 RAVER1 specifically regulates MDA5 activity, revealing a mechanism of differential regulation of MDA5- and RIG-I-mediated innate antiviral response.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribonucleoprotein PTB-binding 1 protein (RAVER1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22709580 These binding assays show that raver1 forms a ternary complex with metavinculin and vinculin mRNA.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19523901 RAVER1 interactions with vinculin and RNA suggest a feed forward pathway in directing messenger RNA to focal adhesions.
19423540 Observational study of gene-disease association. (HuGE Navigator)
17931803 Raver1 gene promoter region shares common features of ubiquitously expressed gene with the interacting splicing regulator PTB

AA Sequence

MAADVSVTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFRNRRKILIRGLPGDV      1 - 70
TNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLP     71 - 140
PSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDA    141 - 210
GQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQ    211 - 280
QADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRGKGLLPEPNILQLLNNLGPSASLQLLLNPL    281 - 350
LHGSAGGKQGLLGAPPAMPLLNGPALSTALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPA    351 - 420
GGGLPPELPPRRGKPPPLLPSVLGPAGGDREALGLGPPAAQLTPPPAPVGLRGSGLRGPLSHFYSGSPTS    421 - 490
YFTSGLQAGLKQSHLSKAIGSSPLGSGEGLLGLSPGPNGHSHLLKVRAGGGDMQGWEAPAPQRPLTRPAL    491 - 560
PSVSRPHWAARNAALPTCCPRPSPAQKAAMWASTPRASAATTRTPT                            561 - 606
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23390309 2013 RAVER1 is a coactivator of MDA5-mediated cellular antiviral response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22709580 2012 The metavinculin tail domain directs constitutive interactions with raver1 and vinculin RNA.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19523901 2009 Raver1 interactions with vinculin and RNA suggest a feed-forward pathway in directing mRNA to focal adhesions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
17931803 2007 Functional characterization of the ribonucleoprotein, PTB-binding 1/Raver1 promoter region.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11724819 2001 Raver1, a dual compartment protein, is a ligand for PTB/hnRNPI and microfilament attachment proteins.
11181995 2001 The sequence of the human genome.