Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 3.9e-06
ependymoma -1.600 4.0e-11
glioblastoma -1.100 4.0e-05
medulloblastoma, large-cell -1.700 8.2e-06
pediatric high grade glioma -1.100 6.6e-04
psoriasis -1.500 2.3e-30

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MPQTLSASDMVTPGSLSPPPTEPTDGEQAGQPLLDGAPSSASLETLIQHLVPTADYYPEKAYIFTFLLSS      1 - 70
RLFIEPRELLARVCHLCIEQQQLDKPVLDKARVRKFGPKLLQLLAEWTETFPRDFQEESTIGHLKDVVGR     71 - 140
IAPCDEAYRKRMHQLLQALHQKLAALRQGPEGLVGADKPISYRTKPPASIHRELLGVCSDPYTLAQQLTH    141 - 210
VELERLRHIGPEEFVQAFVNKDPLASTKPCFSDKTSNLEAYVKWFNRLCYLVATEICMPAKKKQRAQVIE    211 - 280
FFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVRTAKFFILEHQMDPTGNFCNYRTALRGAAH    281 - 350
RSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVECPFEQDAS    351 - 420
ITHYLYTAPIFSEDGLYLASYESESPENQTEKERWKALRSSILGKT                            421 - 466
//

Text Mined References (5)

PMID Year Title