Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.98
PubTator Score 6.12

Knowledge Summary


No data available


  Differential Expression (21)

Disease log2 FC p
osteosarcoma 1.036 3.3e-02
ependymoma 1.600 1.1e-03
glioblastoma 1.900 3.4e-02
cystic fibrosis 1.898 4.7e-06
non-small cell lung cancer -1.102 1.3e-05
intraductal papillary-mucinous adenoma (... 1.200 2.4e-03
intraductal papillary-mucinous carcinoma... 1.500 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.100 5.8e-03
sarcoidosis -1.600 2.1e-02
breast carcinoma 1.400 6.8e-03
fibroadenoma 1.400 8.3e-03
interstitial cystitis -2.800 8.7e-05
pediatric high grade glioma 1.700 1.2e-02
group 3 medulloblastoma 3.900 2.4e-05
non primary Sjogren syndrome sicca -1.100 2.7e-02
subependymal giant cell astrocytoma 1.193 1.6e-02
lung carcinoma 1.400 5.6e-10
spina bifida -1.434 4.5e-02
ductal carcinoma in situ 3.100 7.0e-04
invasive ductal carcinoma 3.100 7.7e-03
pituitary cancer 1.300 2.0e-02

Gene RIF (3)

24703243 Near-genomewide RNAi screening for regulators of BRAF(V600E) -induced senescence identifies RASEF, a gene epigenetically silenced in melanoma.
21890458 overexpression of RAB45 increased the phosphorylation levels of p38, resulting in the induction of apoptosis and inhibition of proliferation of CML progenitor cells
18385040 Homozygosity, in combination with methylation, appears to be the mechanism targeting RASEF in uveal melanoma, and allelic imbalance at this locus supports a TSG role for RASEF.

AA Sequence

VLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCCNG                                  701 - 740

Text Mined References (12)

PMID Year Title
24703243 2014 Near-genomewide RNAi screening for regulators of BRAF(V600E) -induced senescence identifies RASEF, a gene epigenetically silenced in melanoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21890458 2011 Small GTPase RAB45-mediated p38 activation in apoptosis of chronic myeloid leukemia progenitor cells.
18385040 2008 Epigenetic regulation identifies RASEF as a tumor-suppressor gene in uveal melanoma.
17448446 2007 Characterization of Rab45/RASEF containing EF-hand domain and a coiled-coil motif as a self-associating GTPase.
16174859 2005 Mapping of a novel ocular and cutaneous malignant melanoma susceptibility locus to chromosome 9q21.32.
16015647 2005 Delineation of the minimal commonly deleted segment and identification of candidate tumor-suppressor genes in del(9q) acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.