Property Summary

NCBI Gene PubMed Count 31
PubMed Score 115.69
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical adenoma -1.366 3.0e-02
adrenocortical carcinoma -2.121 1.1e-04
atypical teratoid / rhabdoid tumor -2.400 6.3e-09
breast carcinoma -1.600 4.5e-04
cystic fibrosis 1.100 4.3e-03
ductal carcinoma in situ -1.400 4.7e-02
fibroadenoma -2.000 7.7e-03
inflammatory breast cancer -3.000 1.6e-02
interstitial lung disease -2.300 1.6e-02
intraductal papillary-mucinous adenoma (... -1.300 8.2e-03
intraductal papillary-mucinous neoplasm ... -1.800 6.6e-03
lung adenocarcinoma -1.700 1.3e-03
medulloblastoma, large-cell -1.700 9.9e-04
pancreatic ductal adenocarcinoma liver m... -1.233 3.3e-02
pituitary cancer -3.100 3.9e-04
psoriasis -1.600 4.3e-06

Gene RIF (13)

AA Sequence

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGE      1 - 70
VYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPL     71 - 140
VICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS    141 - 210
VQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVI    211 - 280
S//

Text Mined References (33)

PMID Year Title