Property Summary

NCBI Gene PubMed Count 44
PubMed Score 69.38
PubTator Score 97.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -2.200 4.3e-07
esophageal adenocarcinoma 1.900 2.0e-02
cutaneous lupus erythematosus 1.700 1.4e-02
astrocytoma 2.100 2.2e-02
glioblastoma 1.900 2.1e-03
osteosarcoma -2.414 5.4e-04
chronic lymphosyte leukemia -1.200 1.4e-06
posterior fossa group A ependymoma 2.500 1.6e-07
group 3 medulloblastoma -2.000 1.1e-02
atypical teratoid / rhabdoid tumor -1.300 3.6e-02
medulloblastoma, large-cell -2.400 8.8e-04
limb girdle muscular dystrophy 2I 1.384 4.0e-03
juvenile dermatomyositis 2.473 6.0e-10
adrenocortical carcinoma -1.056 3.0e-02
primary pancreatic ductal adenocarcinoma 1.107 3.3e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
lung cancer -3.000 9.7e-05
active Crohn's disease 2.820 3.4e-03
active ulcerative colitis 2.912 4.2e-02
pancreatic cancer 1.300 1.8e-03
interstitial cystitis 1.700 1.3e-02
adult high grade glioma 1.700 2.1e-02
pilocytic astrocytoma 1.800 1.2e-04
primary Sjogren syndrome 1.300 3.8e-03
subependymal giant cell astrocytoma 2.630 3.1e-03
lung carcinoma -2.600 6.2e-26
invasive ductal carcinoma 1.700 4.5e-03
ovarian cancer 2.000 6.3e-05
dermatomyositis 2.100 3.8e-02

Gene RIF (29)

PMID Text
26535695 These observations highlight the importance of RIG-I signaling in anti-HIV innate immunity in macrophages, which may be beneficial for the treatment of HIV and aid in the understanding of the neuropathogenesis of HAND.
26464031 Letter: Interleukin-22 inhibits tazarotene-induced gene 3 expression in keratinocytes via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 Gal1 and gal3 regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 TRIM25 plays an additional role in RIG-I/MDA5 signaling other than RIG-I ubiquitination via activation of NF-kappaB.
26223644 During Crimean-Congo hemorrhagic fever virus infection, RIG-I mediated a type I interferon response via MAVS.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25752576 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25361079 findings provide a new insight into the molecular link between p53, protein acylation and Wnt/beta-catenin signaling whereby RARRES3 plays a pivotal role in modulating the acylation status of signaling proteins.
25315416 MiR-545 exerts its effects in pancreatic ductal adenocarcinoma by directly targeting RIG-1
24867881 RARRES3 downregulation engages metastasis-initiating capabilities by facilitating adhesion of the tumor cells to the lung parenchyma.
24800889 critical for the initiation of IRF-3 phosphorylation, dimerization and downstream gene expression during antiviral innate immune response
24599174 These findings argue that TIG3 is involved in the control of keratinocyte differentiation and that loss of TIG3 in transformed cells contributes to the malignant phenotype.
24401997 We show that the C-terminal hydrophobic domain targets intact TIG3 to the plasma membrane, but when isolated as an independent element localizes at the mitochondria and a segment of the N-terminal hydrophilic region targets the centrosome.
22960220 Low RIG1 expression is associated with testis cancer.
22616991 RIG1 gene is a downstream target of p53 in cancer cell lines
22009441 We conclude that TG1-catalysed cross-linking, regulated by TIG3, might play an important role in the formation of neuronal tau inclusions in certain tauopathies
21858038 Data suggest that pericentrosomal localization of TIG3 is a key event that results in microtubule and microfilament redistribution and pericentrosomal organelle clustering and that leads to cancer cell apoptosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19615464 The tumor suppressors TIG3, HRASLS2 and H-rev107 are involved in the phospholipid metabolism with different physiological roles.
19245694 The NC domain, especially the NC motif, plays the major role in RIG1-mediated pro-apoptotic activity. The RIG1(111-123) dodecapeptide exhibited strong pro-apoptotic activity and has potential as an anticancer drug.
17762858 the TIG3 N-terminal region is required for TIG3-dependent keratinocyte differentiation, and its removal converts TIG3 into a proapoptotic protein
17196792 The proapoptotic and anti-RAS activities of RIG1 are primarily associated with the Golgi localization of the protein.
15856468 TIG3 is negatively regulated by an activated MEK-ERK signaling pathway in ovarian carcinoma.
15850806 identification and characterization of the functional RA response element that is responsible for the RA-mediated induction of RIG1 gene
15742394 altered RARRES3 expression may play a role in the carcinogenesis of the liver and biliary tract.
12928434 TIG3 facilitates the terminal stages in keratinocyte differentiation via activation of type I transglutaminase
12879006 induction of TIG3 is associated with the suppression of anchorage-independent growth in certain aerodigestive tract cancer cells

AA Sequence

MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVG      1 - 70
GCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVA     71 - 140
TALGILVVAGCSFAIRRYQKKATA                                                  141 - 164
//

Text Mined References (46)

PMID Year Title
26535695 2015 RIG-I detects HIV-1 infection and mediates type I interferon response in human macrophages from patients with HIV-1-associated neurocognitive disorders.
26464031 2015 Interleukin-22 inhibits tazarotene-induced gene 3 expression in HaCaT cells via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 2015 Galectins regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 2015 Regulation of MDA5-MAVS Antiviral Signaling Axis by TRIM25 through TRAF6-Mediated NF-?B Activation.
26223644 2015 RIG-I Mediates an Antiviral Response to Crimean-Congo Hemorrhagic Fever Virus.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25752576 2015 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25416956 2014 A proteome-scale map of the human interactome network.
25361079 2015 Involvement of RARRES3 in the regulation of Wnt proteins acylation and signaling activities in human breast cancer cells.
25315416 2014 miR-545 inhibited pancreatic ductal adenocarcinoma growth by targeting RIG-I.
24867881 2014 RARRES3 suppresses breast cancer lung metastasis by regulating adhesion and differentiation.
24800889 2014 Sustained activation of interferon regulatory factor 3 during infection by paramyxoviruses requires MDA5.
24599174 2014 TIG3: an important regulator of keratinocyte proliferation and survival.
24401997 2014 Pericentrosomal localization of the TIG3 tumor suppressor requires an N-terminal hydrophilic region motif.
22960220 2012 Involvement of the prostaglandin D2 signal pathway in retinoid-inducible gene 1 (RIG1)-mediated suppression of cell invasion in testis cancer cells.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22616991 2012 Expression of the class II tumor suppressor gene RIG1 is directly regulated by p53 tumor suppressor in cancer cell lines.
22590509 2012 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22377296 2012 [RIG-I: a viral RNA detector molecular switch].
22009441 2012 Transglutaminase 1 and its regulator tazarotene-induced gene 3 localize to neuronal tau inclusions in tauopathies.
21858038 2011 TIG3 tumor suppressor-dependent organelle redistribution and apoptosis in skin cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20100577 2010 Expression, purification and biochemical characterization of the N-terminal regions of human TIG3 and HRASLS3 proteins.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19615464 2009 Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes.
19245694 2009 Induction of apoptosis by the retinoid inducible growth regulator RIG1 depends on the NC motif in HtTA cervical cancer cells.
17762858 2008 Localization of the TIG3 transglutaminase interaction domain and demonstration that the amino-terminal region is required for TIG3 function as a keratinocyte differentiation regulator.
17196792 2007 RIG1 suppresses Ras activation and induces cellular apoptosis at the Golgi apparatus.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15856468 2005 Suppression of the TIG3 tumor suppressor gene in human ovarian carcinomas is mediated via mitogen-activated kinase-dependent and -independent mechanisms.
15850806 2005 Identification and characterization of the retinoic acid response elements in the human RIG1 gene promoter.
15846304 2005 A novel transglutaminase activator forms a complex with type 1 transglutaminase.
15742394 2005 Decreased expression of type II tumor suppressor gene RARRES3 in tissues of hepatocellular carcinoma and cholangiocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12928434 2003 A novel tumor suppressor protein promotes keratinocyte terminal differentiation via activation of type I transglutaminase.
12879006 2003 Induction of TIG3, a putative class II tumor suppressor gene, by retinoic acid in head and neck and lung carcinoma cells and its association with suppression of the transformed phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11078805 2000 The carboxy-terminal hydrophobic domain of TIG3, a class II tumor suppressor protein, is required for appropriate cellular localization and optimal biological activity.
10955811 2000 Expression of a retinoid-inducible tumor suppressor, Tazarotene-inducible gene-3, is decreased in psoriasis and skin cancer.
10687848 2000 Cloning and characterization of a novel retinoid-inducible gene 1(RIG1) deriving from human gastric cancer cells.
9843971 1998 Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene.
9270552 1997 Molecular mechanisms of tazarotene action in psoriasis.
9204961 1997 Tazarotene-induced gene 2 (TIG2), a novel retinoid-responsive gene in skin.