Property Summary

NCBI Gene PubMed Count 153
PubMed Score 288.31
PubTator Score 448.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.200 4.5e-02
oligodendroglioma -1.300 2.2e-02
psoriasis 1.100 5.6e-03
glioblastoma -1.700 6.6e-05
atypical teratoid / rhabdoid tumor -1.800 4.4e-07
medulloblastoma, large-cell -1.500 1.1e-04
hereditary spastic paraplegia -1.076 3.1e-03
non-small cell lung cancer -1.848 6.7e-27
cystic fibrosis -1.200 5.6e-04
pediatric high grade glioma -1.500 2.5e-05
lung adenocarcinoma -1.800 5.0e-12
Breast cancer -1.200 4.7e-14
invasive ductal carcinoma -1.300 2.3e-04

Gene RIF (108)

PMID Text
26280580 RAP1-mediated MEK/ERK pathway defects in Kabuki syndrome.
25963656 Data indicate that through GTPase-activating proteins ArhGAP29 complex formation Rap1 GTP-binding protein spatially restricts Rho-mediated signaling, which is necessary for endothelial barrier potentiation.
25888632 Rap1- and Rac1-GTPase activation have roles in hypoxia/reoxygenation-experienced cancer cell migration and metastasis via the expression of thymosin beta-4
25856570 Our findings suggest that RAP1 may be a useful biomarker for the diagnosis of ical intraepithelial neoplasia .
25636908 These findings provide further evidence that a crucial role for miR-203 in inhibiting metastasis of PCa through the suppression of Rap1A expression.
25631816 A receptor type-protein tyrosine phosphatase alpha-Src family kinase-Rap1 pathway was identified as responsible for recruiting myosin IIB to the zonula adherens in epithelial cells and supporting contractile tension.
25545047 Rap1 knockdown attenuates prostacyclin (PC)-induced vascular endothelial cell (EC) monolayer recovery.
25533468 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25028810 basal levels of Rap1 activity holds up cell adhesion, whereas sequential regulation of C3G and GAP by IGF-IR reverses the labile Rap1 function from supporting adhesion to promoting migration.
24980975 By inducing and activating Rap1 and Rac1.
24840609 The direct interaction between Zscan4 and Rap1 may explain how Zscan4 rapidly increases telomere length, yielding important information about the role of these proteins in telomere biology.
24790104 a Rap1A/beta1 integrin pathway, activated downstream of G-protein-coupled receptor stimulation and RhoA, in glioblastoma cell proliferation.
24719879 a model by which the small GTPase Rap1 could regulate aES assembly/remodelling.
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24287201 crystal structure of an active, GTP-bound GTPase domain of Rap1 in complex with the Ras association (RA)-pleckstrin homology (PH) structural module of RIAM at 1.65 A, is reported.
23946483 optimal cell migration is associated with cycles of Rap1 activation, membrane egress, and inactivation, and requires the regulated phosphorylation of Rap1 by PKA
23864608 these studies extend of alpha2C-ARs is mediated through Rap1-filamin signaling. Perturbation of this signaling pathway may lead to alterations in alpha2C-AR trafficking and physiological function.
23814056 These data show that HEG1 can recruit the Rap1-KRIT complex to the plasma membrane.
23720748 Data indicate that Epac1-Rap1A-RhoA-ROCK signaling affects Cl- secretion via effects on the apical expression of KCNN4c channels.
23469100 endothelial barrier resistance is determined by the combined antagonistic actions of Rap1 and Rap2
23405264 High Rap1A expression is associated with invasive breast tumors.
23243278 the PI3 kinase/Rap1 pathway is intrinsically impaired in platelets from JAK2V617F-positive essential thrombocythemia patients, resulting in diminished thrombin and thrombopoietin-mediated integrin alpha(IIb)beta(3) activation
23219753 the Aurora-A/Rap-1A pathway is associated with survival, tumor progression, and metastasis of oral cavity squamous cell carcinoma patients.
23209645 Rap1 can induce cell adhesion and stimulate an accelerated rate of cell spreading through mechanisms that bypass the canonical FAK-Src-Paxillin signalling cascade
23209302 It was shown that the kinesin KIF14 associates with the PDZ domain of Radil and negatively regulates Rap1-mediated inside-out integrin activation by tethering Radil on microtubules.
23166790 Constitutive Rap1 activation in human prostate tumor cells promotes hypoxic induction of VEGF and angiogenesis, and PKA antagonizes this effect.
23097489 Studies indicate that Radil regulates neutrophil adhesion and motility by linking Rap1 to beta2-integrin activation. +++ ERROR +++ studies establish that Radil regulates neutrophil adhesion and motility by linking Rap1 to beta2-integrin activation.
22899717 Syndecan-1 restrains migration in lung epithelium by activating Rap1 to slow focal adhesion disassembly.
22859270 High RAP1A expression is associated with esophageal squamous cell carcinoma.
22810897 Abl family kinases modulate T cell-mediated inflammation and chemokine-induced migration through the adaptor HEF1 and the GTPase Rap1.
22738401 Investigated is the role that electrostatic field differences caused by the charge reversal mutation Rap1A K31E play in determining the binding specificity of RalGDS to Rap1A versus Ras.
22723956 The identification of a miR-337-3p as a modulator of cellular response to taxanes, and STAT3 and RAP1A as regulatory targets which mediate that response.
22684501 This article discusses the role of RAP1 and Rap1GAP in squamous cell carcinoma of the head and neck progression in the context of a microRNA-oncogene-tumor suppressor gene axis.
22577140 Structural basis for small G protein effector interaction of Ras-related protein 1 (Rap1) and adaptor protein Krev interaction trapped 1 (KRIT1)
22347375 Co-inhibition of p38 MAPK and Rap1 GTPase reversed the LPS induced breakdown of chemotaxis suggesting that LPS effect requires the combined function of p38 MAPK and Rap1 GTPase
22343288 cAMP induces a conformational change in Epac1 that enables DEP domain-mediated binding to phosphatidic acid, resulting in the tethering of Epac1 at the plasma membrane and subsequent activation of Rap
21750123 Epac1 is expressed in human neutrophils and is involved in cAMP-dependent regulation of Rap1. However, the loading of GTP on Rap1 per se is not sufficient to promote activation of beta2 integrins.
21716322 farnesylthiosalicylic acid-amide inhibits contact sensitivity through Rap1 inhibition
21605078 These results demonstrate a distinct physiological role for Ser(756) of beta2 integrin, in conjunction with the actions of talin and Rap1, during alphaMbeta2 activation in macrophages.
21520057 For the first time, a role has been shown for Rap1-mediated association between adherens junction and tight junction complexes in the 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphorylcholine-induced pulmonary vascular endothelial cell barrier protection.
21468893 Rap1A binds the tumor suppressor Ras association domain family 1A (RASSF1A) in a manner that is regulated by phosphorylation of RASSF1A
21454546 cAMP-responsive Rap1 guanine nucleotide exchange factor, Epac, induces smooth muscle relaxation by down-regulation of RhoA activity
21169361 PA and Rap1 cooperatively regulate RA-RhoGAP activity for promoting neurite outgrowth.
20709748 Results indicate that guanine nucleotide exchange and interactions with SmgGDS splice variants can regulate the entrance and passage of PBR-possessing small GTPases through the prenylation pathway.
20665668 Rap1-mediated activation of alpha(M)beta(2) in macrophages shares both common and distinct features from Rap1 activation of alpha(IIb)beta(3) expressed in CHO cells.
20548944 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20547757 Ran-GTP and Epac1 interact with each other in vivo and in vitro. This binding requires a previously uncharacterized Ras association domain in Epac1.
20339002 Activated Rap1A promotes glucose-stimulated insulin secretion, islet cell hypertrophy, and islet cell proliferation, the latter exclusively through mammalian target of rapamycin complex 1
20048162 Gbetagamma subunits enter in a protein complex with activated Rap1a and its effector Radil; this complex is required downstream of receptor stimulation for the activation of integrins and the positive modulation of cell-matrix adhesiveness.
19763083 TRF2 inhibits non-homologous end joining, in part, by recruiting human RAP1 to telomeres.
19710505 results identify Epac and Rap1 as inhibitory regulators of the angiogenic process
19638416 Rap1 activity is regulated during mitosis.
19464664 Activation of Rap1 by PGE(2) via cAMP-signaling may play an important role in the articular pathology of rheumatoid arthritis
19176753 JAM-A dimerization facilitates formation of a complex with Afadin and PDZ-GEF2 that activates Rap1A, which regulates beta1 integrin levels and cell migration.
19098287 a minimized 50-residue Rap-RIAM module containing the talin binding site of RIAM joined to the membrane-targeting sequence of Rap1A. This minimized Rap-RIAM module was sufficient to target talin to the plasma membrane and to mediate integrin activation
19001122 Rap1 as another downstream target of the Abl-CrkII signaling module and show that Abl-CrkII collaborates with Rho-ROCK1 to stimulate cell retraction.
18948674 RAP1 mutation does not play an important role in papillary thyroid carcinoma pathogenesis.
18948674 Observational study of gene-disease association. (HuGE Navigator)
18832707 Rap1 and its exchange factor C3G in mediating Fc gammaR-dependent phagocytosis.
18809728 Results identify a mechanism by which the WAVE2 complex regulates T cell receptor signaling to Rap1 and integrin activation via Abl- and CrkL-C3G.
18805968 Rap1a and Rap1b are essential for the conformational activation of beta1-integrins in endothelial cells
18789886 The beta2 integrin-dependent exocytosis of specific and gelatinase B-containing granules is responsible for the translocation of Rap1 and Rap2 to the plasma membrane in human neutrophils.
18625726 Results suggest that Rap1a is a key regulator of fibroblast growth factor 2-induced angiogenesis and together with Rap1b controls endothelial cell functions.
18487435 Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors.
18390735 activation of functional alpha(4) integrin activity in resting eosinophils is mediated by Rap1 provided that the intracellular-free Ca(2+) is at a normal homeostatic concentration
18172027 Epac1 was shown to be responsible for these actin changes and to colocalize with microtubules in human umbilical vein endothelial cells.
17716979 interaction surfaces in RAPL-Rap1 and RAPL-Rap2 complexes are different and that a single residue in the switch I region of Rap proteins (residue 39) contributes considerably to the different kinetics of these protein-protein interactions.
17702895 Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 mediated human T-cell adhesion.
17517894 IQGAP1 may link the calmodulin and Rap1 signaling pathways
17487743 Rap1 regulates malignant transformation mechanisms of hematopoietic progenitors
17382517 These findings raise the possibility that Rgl3 mediates interaction between Ras/Rap-family proteins and profilin II, an important activator of actin polymerization.
17300802 While Rap1GAP(N290A) is completely inactive on wild-type Rap1, it can act on Rap1(T61Q), arguing that Asn290 in trans has a role in catalysis similar to that of the intrinsic Gln in Ras and Rho.
17068197 Rap1 mediates cyclic AMP-stimulated neurotensin secretion downstream of both Epac and protein kinase A signaling pathways
16963453 A study that demonstrated the engagement of beta2 integrins on human neutrophils increased the levels of GTP-bound Rap1 and Rap2 is presented.
16888288 The patients with emphysema had significantly higher percentages of type II cells positive for p16INK4a and p21CIP1/WAF1/Sdi1 than the asymptomatic smokers and nonsmokers.
16820412 Results suggest that Dok-4, through activation of the Rap1-ERK1/2 pathway, regulates GDNF-mediated neurite outgrowth during neuronal development.
16751380 The Epac1-Rap1 pathway is present in both monocytes and macrophages, but only regulates specific immune effector functions
16716258 TIMP-2 mediated alteration in cell morphology requires Rap1, TIMP-2 may recruit Rap1 to sites of actin cytoskeleton remodeling necessary for cell spreading, and enhanced cell adhesion by TIMP-2 expression may hinder cell migration
16540189 RT-PCR analysis of mRNA extracted from highly purified reticulocytes confirmed the expression of Rap2b, but not Rap2a, Rap2c, Rap1a or Rap1b.
16219685 first evidence of an E-cadherin-modulated endosomal signaling pathway involving Rap1, and suggest that cadherins may have a novel modulatory role in integrin adhesive functions by fine-tuning Rap1 activation
16118622 The RAP1A gene mutation is a rare event in myelodysplastic syndromes(MDS) bone marrow cells.
15725075 On ephrinB1 stimulation, the small GTPases Rho and Ras are activated and Rap1 is inactivated.
15711749 cGKI inhibited ADP-induced Rap 1 activation induced by the Galpha(i)-coupled P2Y12 receptor alone, i.e. independently of effects on Ca2+-signalling
15677455 JAM1 regulates epithelial cell morphology and beta1 integrin expression by modulating activity of the small GTPase Rap1.
15661741 Rap1 GTPase inhibits leukocyte transmigration by promoting endothelial barrier function.
15657046 the G(alpha)o/i-coupled cannabinoid receptor, by regulating the proteasomal degradation of Rap1GAPII, activates Rap1 to induce neurite outgrowth.
15613546 Epac-mediated Rap1 activation may represent an important signaling pathway for promoting sickle cell adhesion.
15601837 cAMP-Epac-Rap1 signaling promotes decreased cell permeability by enhancing VE-cadherin-mediated adhesion lined by the rearranged cortical actin
15591041 MAP1A LC2 is a biological enhancer of EPAC1 activity toward Rap1 and associated downstream signaling mechanisms
15569673 Rap1 activation contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL localizes
15479739 Rap1 promotes cell spreading by localizing a subset of Rac GEFs to sites of active lamellipodia extension
15374886 Activation of Epac results in markedly enhanced basal endothelial barrier function by increasing cortical actin and subsequent redistribution of adherens and tight junctional molecules to cell-cell contacts
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
15254236 Rap1 plays a vital role in the establishment of E-cadherin-based cell-cell adhesion
15064832 mRNA expression of Rap1A protein in the spermatogenic cells of azoospermic was stronger than that in those of the fertile testes
15031297 a previously uncharacterized domain spanning amino acids 85-89 of Rap1A plays a pivotal role in its perinuclear localization and acts dominantly over COOH-terminal lipid modification of Ha-Ras
14757755 Results suggest that membrane localizations of Rap1 are dynamically regulated, and the cell membrane is the principle platform from which Rap1 signaling emanates.
14607972 Rap1 GTPase has functions in malignancy (review)
14576067 Eph/ephrin signaling enhances the ability of platelet agonists to cause aggregation provided that those agonists can increase cytosolic Ca(++) and this is accomplished in part by activating Rap1
14551137 inherited Rap1 activation defect associated with a pathologic disorder in leukocyte integrin function; we herein term it LAD-III, leukocyte adhesion deficiency syndrome
13679863 RAP1A is prominently expressed in the nucleus of squamous carcinomas.
12891710 rap1 inhibits proliferation in keratinocytes
12393539 cAMP inhibits both Ras and Rap1 activation in primary human T lymphocytes, but only Ras inhibition correlates with blockade of cell cycle progression.
12393469 Rap1 may represent a critical control point in the stromal inhibition of megakaryoytic differentiation.
12221082 Galpha and Gbeta gamma require distinct Src-dependent pathways for its activation
12091396 role in regulating phorbol 12-myristate 13-acetate-stimulated but not ligand-induced beta 1 integrin-dependent leukocyte adhesion
12082090 ERK activation by cAMP does not require RAP1
11788600 Consequences of mevalonate depletion. Differential transcriptional, translational, and post-translational up-regulation

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKSCLLL                              141 - 184
//

Text Mined References (157)

PMID Year Title
26280580 2015 RAP1-mediated MEK/ERK pathway defects in Kabuki syndrome.
25963656 2015 Rap1 Spatially Controls ArhGAP29 To Inhibit Rho Signaling during Endothelial Barrier Regulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25888632 2015 Hypoxia/reoxygenation-experienced cancer cell migration and metastasis are regulated by Rap1- and Rac1-GTPase activation via the expression of thymosin beta-4.
25856570 2015 RAP1 GTPase overexpression is associated with cervical intraepithelial neoplasia.
25636908 2015 MiR-203 down-regulates Rap1A and suppresses cell proliferation, adhesion and invasion in prostate cancer.
25631816 2015 An RPTP?/Src family kinase/Rap1 signaling module recruits myosin IIB to support contractile tension at apical E-cadherin junctions.
25545047 2015 Prostacyclin post-treatment improves LPS-induced acute lung injury and endothelial barrier recovery via Rap1.
25533468 2015 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25028810 2014 The small GTPase Rap1 promotes cell movement rather than stabilizes adhesion in epithelial cells responding to insulin-like growth factor I.
24980975 2014 Streptococcus pneumoniae ClpL modulates adherence to A549 human lung cells through Rap1/Rac1 activation.
24840609 2014 Zscan4 interacts directly with human Rap1 in cancer cells regardless of telomerase status.
24790104 2014 The Ras-related protein, Rap1A, mediates thrombin-stimulated, integrin-dependent glioblastoma cell proliferation and tumor growth.
24719879 2014 The dynamic of the apical ectoplasmic specialization between spermatids and Sertoli cells: the case of the small GTPase Rap1.
24287201 2014 The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
23946483 2013 Protein kinase A-dependent phosphorylation of Rap1 regulates its membrane localization and cell migration.
23864608 2013 Cyclic AMP-Rap1A signaling mediates cell surface translocation of microvascular smooth muscle ?2C-adrenoceptors through the actin-binding protein filamin-2.
23814056 2013 The structure of the ternary complex of Krev interaction trapped 1 (KRIT1) bound to both the Rap1 GTPase and the heart of glass (HEG1) cytoplasmic tail.
23720748 2013 The Epac1 signaling pathway regulates Cl- secretion via modulation of apical KCNN4c channels in diarrhea.
23469100 2013 Rap1 and Rap2 antagonistically control endothelial barrier resistance.
23405264 2013 ?-Arrestin2 regulates lysophosphatidic acid-induced human breast tumor cell migration and invasion via Rap1 and IQGAP1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23243278 2013 Dysfunction of the PI3 kinase/Rap1/integrin ?(IIb)?(3) pathway underlies ex vivo platelet hypoactivity in essential thrombocythemia.
23219753 2013 Overexpression of Rap-1A indicates a poor prognosis for oral cavity squamous cell carcinoma and promotes tumor cell invasion via Aurora-A modulation.
23209645 2012 Rap1 can bypass the FAK-Src-Paxillin cascade to induce cell spreading and focal adhesion formation.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23166790 2012 A novel interplay between Rap1 and PKA regulates induction of angiogenesis in prostate cancer.
23097489 2012 Radil controls neutrophil adhesion and motility through ?2-integrin activation.
22899717 2012 Syndecan-1 controls cell migration by activating Rap1 to regulate focal adhesion disassembly.
22859270 2012 MiR-196a binding-site SNP regulates RAP1A expression contributing to esophageal squamous cell carcinoma risk and metastasis.
22810897 2012 Abl family kinases modulate T cell-mediated inflammation and chemokine-induced migration through the adaptor HEF1 and the GTPase Rap1.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22738401 2012 Role of electrostatics in differential binding of RalGDS to Rap mutations E30D and K31E investigated by vibrational spectroscopy of thiocyanate probes.
22723956 2012 miR-337-3p and its targets STAT3 and RAP1A modulate taxane sensitivity in non-small cell lung cancers.
22684501 Rap1 and its regulatory proteins: the tumor suppressor, oncogene, tumor suppressor gene axis in head and neck cancer.
22577140 2012 Structural basis for small G protein effector interaction of Ras-related protein 1 (Rap1) and adaptor protein Krev interaction trapped 1 (KRIT1).
22347375 2012 TLR signaling paralyzes monocyte chemotaxis through synergized effects of p38 MAPK and global Rap-1 activation.
22343288 2012 cAMP regulates DEP domain-mediated binding of the guanine nucleotide exchange factor Epac1 to phosphatidic acid at the plasma membrane.
21840392 2011 Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control.
21750123 2011 Exchange protein directly activated by cAMP 1 (Epac1) is expressed in human neutrophils and mediates cAMP-dependent activation of the monomeric GTPase Rap1.
21716322 2011 Inhibition of contact sensitivity by farnesylthiosalicylic acid-amide, a potential Rap1 inhibitor.
21605078 2011 Ser756 of ?2 integrin controls Rap1 activity during inside-out activation of ?M?2.
21520057 2011 Association between adherens junctions and tight junctions via Rap1 promotes barrier protective effects of oxidized phospholipids.
21468893 2011 The tumor suppressor RASSF1A is a novel effector of small G protein Rap1A.
21454546 2011 The cAMP-responsive Rap1 guanine nucleotide exchange factor, Epac, induces smooth muscle relaxation by down-regulation of RhoA activity.
21269460 2011 Initial characterization of the human central proteome.
21169361 2011 Dual regulation of RA-RhoGAP activity by phosphatidic acid and Rap1 during neurite outgrowth.
20709748 2010 Splice variants of SmgGDS control small GTPase prenylation and membrane localization.
20665668 2010 Rap1 controls activation of the ?(M)?(2) integrin in a talin-dependent manner.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
20547757 2010 The interaction of Epac1 and Ran promotes Rap1 activation at the nuclear envelope.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20339002 2010 Rap1 promotes multiple pancreatic islet cell functions and signals through mammalian target of rapamycin complex 1 to enhance proliferation.
20048162 2010 G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil.
19763083 2009 Human RAP1 inhibits non-homologous end joining at telomeres.
19710505 2009 A novel interplay between Epac/Rap1 and mitogen-activated protein kinase kinase 5/extracellular signal-regulated kinase 5 (MEK5/ERK5) regulates thrombospondin to control angiogenesis.
19638416 2009 Dynamic changes in Rap1 activity are required for cell retraction and spreading during mitosis.
19464664 2009 Prostaglandin E2 activates Rap1 via EP2/EP4 receptors and cAMP-signaling in rheumatoid synovial fibroblasts: involvement of Epac1 and PKA.
19176753 2009 Junctional adhesion molecule A interacts with Afadin and PDZ-GEF2 to activate Rap1A, regulate beta1 integrin levels, and enhance cell migration.
19098287 2009 RIAM activates integrins by linking talin to ras GTPase membrane-targeting sequences.
19001122 2008 Induction of cell retraction by the combined actions of Abl-CrkII and Rho-ROCK1 signaling.
18948674 2009 Mutation analysis of RAP1 gene in papillary thyroid carcinomas.
18832707 2008 Rap1 activation is required for Fc gamma receptor-dependent phagocytosis.
18809728 2008 The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
18805968 2009 Role of the small GTPase Rap1 for integrin activity regulation in endothelial cells and angiogenesis.
18789886 2008 Beta2 integrins target Rap GTPases to the plasma membrane by means of degranulation.
18625726 2008 Rap1a is a key regulator of fibroblast growth factor 2-induced angiogenesis and together with Rap1b controls human endothelial cell functions.
18487435 2008 Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors.
18390735 2008 Homeostatic intracellular-free Ca2+ is permissive for Rap1-mediated constitutive activation of alpha4 integrins on eosinophils.
18172027 2008 Role of Epac1, an exchange factor for Rap GTPases, in endothelial microtubule dynamics and barrier function.
17954608 2007 KRIT-1/CCM1 is a Rap1 effector that regulates endothelial cell cell junctions.
17916086 2007 Krit 1 interactions with microtubules and membranes are regulated by Rap1 and integrin cytoplasmic domain associated protein-1.
17716979 2007 Characterization of interactions of adapter protein RAPL/Nore1B with RAP GTPases and their role in T cell migration.
17704304 2007 A Rap GTPase interactor, RADIL, mediates migration of neural crest precursors.
17702895 2007 Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 but not VLA-4 integrin mediated human T-cell adhesion.
17517894 2007 IQGAP1 binds Rap1 and modulates its activity.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
17487743 2007 Active Rap1, a small GTPase that induces malignant transformation of hematopoietic progenitors, localizes in the nucleus and regulates protein expression.
17382517 2007 Identification of Rgl3 as a potential binding partner for Rap-family small G-proteins and profilin II.
17300802 2007 Insight into catalysis of a unique GTPase reaction by a combined biochemical and FTIR approach.
17068197 2007 Cyclic adenosine 5'-monophosphate-stimulated neurotensin secretion is mediated through Rap1 downstream of both Epac and protein kinase A signaling pathways.
16963453 2006 Nitric oxide produced in response to engagement of beta2 integrins on human neutrophils activates the monomeric GTPases Rap1 and Rap2 and promotes adhesion.
16888288 2006 Alveolar cell senescence in patients with pulmonary emphysema.
16820412 2006 Dok-4 regulates GDNF-dependent neurite outgrowth through downstream activation of Rap1 and mitogen-activated protein kinase.
16751380 2006 The cyclic AMP-Epac1-Rap1 pathway is dissociated from regulation of effector functions in monocytes but acquires immunoregulatory function in mature macrophages.
16716258 2006 TIMP-2 promotes cell spreading and adhesion via upregulation of Rap1 signaling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16581250 2006 p130Cas: a versatile scaffold in signaling networks.
16540189 2006 Rap2, but not Rap1 GTPase is expressed in human red blood cells and is involved in vesiculation.
16284401 2006 Identification of a switch in neurotrophin signaling by selective tyrosine phosphorylation.
16219685 2005 E-cadherin endocytosis regulates the activity of Rap1: a traffic light GTPase at the crossroads between cadherin and integrin function.
16118622 2005 Mutation in RAP1 is a rare event in myelodysplastic syndromes.
16005629 2005 Integrins and Src: dynamic duo of adhesion signaling.
15725075 2005 Down-regulation of Rap1 activity is involved in ephrinB1-induced cell contraction.
15711749 2005 The NO/cGMP pathway inhibits Rap 1 activation in human platelets via cGMP-dependent protein kinase I.
15677455 2005 Junctional adhesion molecule 1 regulates epithelial cell morphology through effects on beta1 integrins and Rap1 activity.
15661741 2005 Rap1 GTPase inhibits leukocyte transmigration by promoting endothelial barrier function.
15657046 2005 Cannabinoid receptor-induced neurite outgrowth is mediated by Rap1 activation through G(alpha)o/i-triggered proteasomal degradation of Rap1GAPII.
15613546 2005 Role of Rap1 in promoting sickle red blood cell adhesion to laminin via BCAM/LU.
15601837 2005 Cyclic AMP potentiates vascular endothelial cadherin-mediated cell-cell contact to enhance endothelial barrier function through an Epac-Rap1 signaling pathway.
15591041 2005 MAP1A light chain 2 interacts with exchange protein activated by cyclic AMP 1 (EPAC1) to enhance Rap1 GTPase activity and cell adhesion.
15569673 2005 Local activation of Rap1 contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL, a Rap1-associating molecule, localizes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479739 2004 Rap1 promotes cell spreading by localizing Rac guanine nucleotide exchange factors.
15374886 2005 Regulation of vascular endothelial barrier function by Epac, a cAMP-activated exchange factor for Rap GTPase.
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15254236 2004 Rap1 regulates the formation of E-cadherin-based cell-cell contacts.
15064832 2004 Expression and significance of Rap1A in testes of azoospermic subjects.
15031297 2004 Identification of a novel domain of Ras and Rap1 that directs their differential subcellular localizations.
15031288 2004 Identification and characterization of rain, a novel Ras-interacting protein with a unique subcellular localization.
14757755 2004 Rap1 up-regulation and activation on plasma membrane regulates T cell adhesion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607972 2003 Rap1 GTPase: functions, regulation, and malignancy.
14576067 2004 Signaling by ephrinB1 and Eph kinases in platelets promotes Rap1 activation, platelet adhesion, and aggregation via effector pathways that do not require phosphorylation of ephrinB1.
14551137 2004 LAD-III, a leukocyte adhesion deficiency syndrome associated with defective Rap1 activation and impaired stabilization of integrin bonds.
13679863 2003 Rap1A and rap1B ras-family proteins are prominently expressed in the nucleus of squamous carcinomas: nuclear translocation of GTP-bound active form.
12891710 2003 Rap1, a small GTP-binding protein is upregulated during arrest of proliferation in human keratinocytes.
12845325 2003 RAPL, a Rap1-binding molecule that mediates Rap1-induced adhesion through spatial regulation of LFA-1.
12590145 2003 AF-6 controls integrin-mediated cell adhesion by regulating Rap1 activation through the specific recruitment of Rap1GTP and SPA-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464615 2003 Cyclic AMP-independent involvement of Rap1/B-Raf in the angiotensin II AT2 receptor signaling pathway in NG108-15 cells.
12444546 2002 Differential roles of Ras and Rap1 in growth factor-dependent activation of phospholipase C epsilon.
12393539 2003 cAMP inhibits both Ras and Rap1 activation in primary human T lymphocytes, but only Ras inhibition correlates with blockade of cell cycle progression.
12393469 2003 Stromal inhibition of megakaryocytic differentiation is associated with blockade of sustained Rap1 activation.
12221082 2002 Galpha and Gbeta gamma require distinct Src-dependent pathways to activate Rap1 and Ras.
12091396 2002 The GTPase Rap1 regulates phorbol 12-myristate 13-acetate-stimulated but not ligand-induced beta 1 integrin-dependent leukocyte adhesion.
12082090 2002 MAP kinase stimulation by cAMP does not require RAP1 but SRC family kinases.
11880369 2002 RasGRP4 is a novel Ras activator isolated from acute myeloid leukemia.
11788600 2002 Consequences of mevalonate depletion. Differential transcriptional, translational, and post-translational up-regulation of Ras, Rap1a, RhoA, AND RhoB.
11786539 2002 The delta subunit of retinal rod cGMP phosphodiesterase regulates the membrane association of Ras and Rap GTPases.
11429608 2001 Spatio-temporal images of growth-factor-induced activation of Ras and Rap1.
11359771 2001 RA-GEF-1, a guanine nucleotide exchange factor for Rap1, is activated by translocation induced by association with Rap1*GTP and enhances Rap1-dependent B-Raf activation.
11335720 2001 Prenylated Rab acceptor protein is a receptor for prenylated small GTPases.
11022048 2001 Regulation of a novel human phospholipase C, PLCepsilon, through membrane targeting by Ras.
10926822 2000 RGS14 is a novel Rap effector that preferentially regulates the GTPase activity of galphao.
10922060 2000 The junctional multidomain protein AF-6 is a binding partner of the Rap1A GTPase and associates with the actin cytoskeletal regulator profilin.
10777492 2000 Regulatory proteins of R-Ras, TC21/R-Ras2, and M-Ras/R-Ras3.
10608844 1999 RA-GEF, a novel Rap1A guanine nucleotide exchange factor containing a Ras/Rap1A-associating domain, is conserved between nematode and humans.
10224125 1999 Thermodynamic and kinetic characterization of the interaction between the Ras binding domain of AF6 and members of the Ras subfamily.
10085114 1999 Identification and characterization of potential effector molecules of the Ras-related GTPase Rap2.
9882515 1999 RAP1A GTP/GDP cycles determine the intracellular location of the late endocytic compartments and contribute to myogenic differentiation.
9867809 1999 Effect of phosphorylation on activities of Rap1A to interact with Raf-1 and to suppress Ras-dependent Raf-1 activation.
9285558 1997 Association of Krev-1/rap1a with Krit1, a novel ankyrin repeat-containing protein encoded by a gene mapping to 7q21-22.
9069267 1997 Signal transduction by the neurotrophin receptors.
8756332 1996 Ras/Rap effector specificity determined by charge reversal.
8631894 1996 Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation.
8449039 1993 Mapping of the KREV1 transformation suppressor gene and its pseudogene (KREV1P) to human chromosome 1p13.3 and 14q24.3, respectively, by fluorescence in situ hybridization.
7791872 1995 The 2.2 A crystal structure of the Ras-binding domain of the serine/threonine kinase c-Raf1 in complex with Rap1A and a GTP analogue.
3144274 1988 Identification of a platelet Mr 22,000 GTP-binding protein as the novel smg-21 gene product having the same putative effector domain as the ras gene products.
3143720 1988 A novel small molecular weight GTP-binding protein with the same putative effector domain as the ras proteins in bovine brain membranes. Purification, determination of primary structure, and characterization.
3141412 1988 Purification and characterization of the 22,000-dalton GTP-binding protein substrate for ADP-ribosylation by botulinum toxin, G22K.
3045729 1988 Human cDNAs rap1 and rap2 homologous to the Drosophila gene Dras3 encode proteins closely related to ras in the 'effector' region.
2642744 1989 A ras-related gene with transformation suppressor activity.
2507536 1989 Purification, identification, and characterization of two GTP-binding proteins with molecular weights of 25,000 and 21,000 in human platelet cytosol. One is the rap1/smg21/Krev-1 protein and the other is a novel GTP-binding protein.
2108841 1990 Chromosome mapping of the human RAS-related RAP1A, RAP1B, and RAP2 genes to chromosomes 1p12----p13, 12q14, and 13q34, respectively.
1899909 1991 The COOH-terminal domain of the Rap1A (Krev-1) protein is isoprenylated and supports transformation by an H-Ras:Rap1A chimeric protein.
1312373 1992 Subcellular distribution of the Rap1A protein in human neutrophils: colocalization and cotranslocation with cytochrome b559.