Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.38
PubTator Score 6.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 5.1e-17
malignant mesothelioma 3232 1.3e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.0
Disease Target Count Z-score Confidence
acute lymphocytic leukemia 33 3.608 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.500 5.1e-17
malignant mesothelioma -3.000 1.3e-08

Gene RIF (4)

AA Sequence

MALHFQSLAELEVLCTHLYIGTDLTQRIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKL      1 - 70
VSRVSPLPVEQRMDIRNYILNYVASQPKLAPFVIQALIQVIAKITKLGWFEVQKDQFVFREIIADVKKFL     71 - 140
QGTVEHCIIGVIILSELTQEMNLVDYSRPSAKHRKIATSFRDTSLKDVLVLACSLLKEVFAKPLNLQDQC    141 - 210
QQNLVMQVLKLVLNCLNFDFIGSSADESADDLCTVQIPTTWRTIFLEPETLDLFFNLYHSLPPLLSQLAL    211 - 280
SCLVQFASTRRSLFNSPERAKYLGNLIKGVKRILENPQGLSDPGNYHEFCRFLARLKTNYQLGELVMVKE    281 - 350
YPEVIRLIANFTITSLQHWEFAPNSVHYLLTLWQRMVASVPFVKSTEPHLLDTYAPEITKAFITSRLDSV    351 - 420
AIVVRDHLDDPLDDTATVFQQLEQLCTVSRCEYEKTCALLVQLFDQNAQNYQKLLHPYSGVTVDITIQEG    421 - 490
RLAWLVYLVGTVVGGRLTYTSTDEHDAMDGELSCRVFQLISLMDTGLPRCCNEKIELAILWFLDQFRKTY    491 - 560
VGDQLQRTSKVYARMSEVLGITDDNHVLETFMTKIVTNLKYWGRYEPVISRTLQFLNDLSVGYILLKKLV    561 - 630
KIDAVKFMLKNHTSEHFPFLGISDNHSLSDFRCRTTFYTALTRLLMVDLGEDEDEFENFMLPLTVAFETV    631 - 700
LQIFNNNFKQEDVKRMLIGLARDLRGIAFALNTKTSYTMLFDWMYPTYLPLLQNAVERWYGEPTCTTPIL    701 - 770
KLMAELMQNRSQRLNFDVSSPNGILLFREASKMVCTYGNQILSLGSLSKDQIYPMKLKGISICYSALKSA    771 - 840
LCGNYVSFGVFKLYGDNHFDNVLQAFVKMLLSVSHSDLLQYRKLSQSYYPLLECLTQDHMSFIINLEPPV    841 - 910
LMYVLTSISEGLTTLDTVVSSSCCTSLDYIVTYLFKHIAKEGKKPLRCREATQAGQRLLHFMQQNPDVLQ    911 - 980
QMMSVLMNTIVFEDCRNQWSVSRPLLGLILLNEKYFSELRASLINSQPLPKQEVLAQCFRNLMEGVEQNL    981 - 1050
SVKNRDRFTQNLSVFRRDVAEALRSDGNTEPCSLDMMS                                   1051 - 1088
//

Text Mined References (9)

PMID Year Title