Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.68
PubTator Score 9.33

Knowledge Summary


No data available


  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.476 2.8e-02
adrenocortical carcinoma -2.000 2.1e-04
adult high grade glioma -1.100 7.0e-04
Atopic dermatitis -1.400 7.8e-04
atypical teratoid / rhabdoid tumor -1.900 4.0e-04
Breast cancer -1.800 5.4e-04
colon cancer -2.300 1.0e-02
ductal carcinoma in situ -1.400 7.7e-03
glioblastoma -1.200 4.3e-04
group 4 medulloblastoma -1.200 7.7e-03
intraductal papillary-mucinous carcinoma... -1.600 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.400 1.5e-02
invasive ductal carcinoma -1.900 2.2e-02
lung adenocarcinoma -1.700 4.9e-11
lung cancer -2.700 1.6e-04
non-small cell lung cancer -2.366 1.7e-27
psoriasis -2.100 2.1e-08
ulcerative colitis 1.100 4.9e-03

Gene RIF (1)

AA Sequence

AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK                                  491 - 530

Text Mined References (12)

PMID Year Title