Property Summary

NCBI Gene PubMed Count 76
PubMed Score 84.80
PubTator Score 70.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.400 1.0e-05
malignant mesothelioma 1.800 4.8e-06
osteosarcoma 1.535 1.2e-06
psoriasis -1.100 3.4e-02
tuberculosis 1.200 3.2e-05

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (39)

AA Sequence

MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGI      1 - 70
KAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVY     71 - 140
IDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILD    141 - 210
SVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDL    211 - 280
SLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFC    281 - 350
SVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF                                        351 - 384
//

Text Mined References (76)

PMID Year Title