Property Summary

NCBI Gene PubMed Count 25
PubMed Score 57.83
PubTator Score 48.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.650 4.2e-03
malignant mesothelioma -1.300 3.0e-06
psoriasis 1.400 2.4e-04
osteosarcoma 1.441 2.4e-04
pancreatic ductal adenocarcinoma liver m... -1.703 4.4e-02
primary Sjogren syndrome -1.100 1.1e-02
ovarian cancer 3.000 3.2e-07

 GO Function (1)

Gene RIF (12)

PMID Text
23705972 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
23077317 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
23068607 Results suggest that NDRG2 and prenylated Rab acceptor-1 (PRA1) might act synergistically to prevent signaling of T-cell facto/beta-catenin.
21798244 Prenylated Rab acceptor protein 1 (PRA1) was identified as an interacting partner of SNCA.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592422 These findings delineated novel roles of PRA1 in lipid transport and cell migration.
19913121 Observational study of gene-disease association. (HuGE Navigator)
16930546 in vivo modulation of PRA1 may be involved in TCF/beta-catenin signaling, as well as cellular proliferation and tumorigenesis
16917502 Coexpression of a PRA1 export mutant or knockdown of PRA1 led to redistribution of LMP1 and its associated signaling molecules to the endoplasmic reticulum and subsequent impairment of LMP1-induced NF-kappaB activation.
15914857 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
14574414 findings show Yip3 acts catalytically to dissociate complexes of endosomal Rabs bound to GDI and to deliver them onto membranes; propose that the conserved Yip proteins serve as GDI-displacement factors for the targeting of Rab GTPases in eukaryotic cells
11739697 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)

AA Sequence

MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRN      1 - 70
VEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISF     71 - 140
PFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV                             141 - 185
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23068607 2012 NDRG2 and PRA1 interact and synergistically inhibit T-cell factor/?-catenin signaling.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21798244 2011 Human ?-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592422 2011 Proteome-wide dysregulation by PRA1 depletion delineates a role of PRA1 in lipid transport and cell migration.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19060904 2009 An empirical framework for binary interactome mapping.
17786215 2007 The N-Myc down regulated Gene1 (NDRG1) Is a Rab4a effector involved in vesicular recycling of E-cadherin.
16930546 2006 Prenylated Rab acceptor 1 (PRA1) inhibits TCF/beta-catenin signaling by binding to beta-catenin.
16917502 2006 PRA1 promotes the intracellular trafficking and NF-kappaB signaling of EBV latent membrane protein 1.
16481131 2006 Genomic organization, expression profile, and characterization of the new protein PRA1 domain family, member 2 (PRAF2).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15922294 2005 NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574414 2003 Yip3 catalyses the dissociation of endosomal Rab-GDI complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520070 2001 Expression analysis and chromosomal assignment of PRA1 and RILP genes.
11335720 2001 Prenylated Rab acceptor protein is a receptor for prenylated small GTPases.
11096102 2001 PRA isoforms are targeted to distinct membrane compartments.
10751420 2000 PRA1 inhibits the extraction of membrane-bound rab GTPase by GDI1.
10707984 2000 Piccolo, a presynaptic zinc finger protein structurally related to bassoon.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9341137 1997 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor.