Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.83
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -1.071 9.6e-05
glioblastoma -1.700 7.4e-03
cystic fibrosis -2.409 2.2e-06
periodontitis 1.200 3.4e-27
atypical teratoid / rhabdoid tumor -1.700 5.9e-04
medulloblastoma, large-cell -2.200 1.4e-04
lung cancer 2.600 3.6e-04
ulcerative colitis 1.800 3.2e-03
sarcoidosis 1.100 3.6e-02
interstitial cystitis 1.800 1.3e-04
pediatric high grade glioma -1.200 6.8e-03
primary Sjogren syndrome 1.300 9.8e-04
psoriasis -1.500 5.8e-11
lung carcinoma 1.500 3.3e-13
spina bifida -1.974 2.6e-02
Pick disease 1.100 6.4e-05
mucosa-associated lymphoid tissue lympho... 1.602 2.9e-02
ductal carcinoma in situ -1.500 2.5e-04
ovarian cancer -2.700 7.1e-13

Gene RIF (2)

PMID Text
23615442 Data indicate taht the parasitophorous vacuole (PV), marked with Rab14, Rab30, or Rab43, colocalize with host-derived sphingolipids in the vacuolar space.
22188167 Rab30 is primarily expressed in the Golgi apparatus and is required for the structural integrity of this organelle.

AA Sequence

MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER      1 - 70
FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF     71 - 140
SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN           141 - 203
//

Text Mined References (17)

PMID Year Title
23615442 2013 Toxoplasma gondii salvages sphingolipids from the host Golgi through the rerouting of selected Rab vesicles to the parasitophorous vacuole.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
22566634 2012 The genetic architecture of economic and political preferences.
22188167 2012 Rab30 is required for the morphological integrity of the Golgi apparatus.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9792283 1998 Small GTP-binding proteins in human endothelial cells.
8863739 1996 Molecular cloning of two novel rab genes from human melanocytes.