Property Summary

NCBI Gene PubMed Count 50
PubMed Score 62.74
PubTator Score 50.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

AA Sequence

MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG      1 - 70
LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA     71 - 140
RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC    141 - 210
ISL                                                                       211 - 213
//

Text Mined References (52)

PMID Year Title