Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCM      1 - 70
AAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMI     71 - 140
ARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA                                 141 - 181
//

Text Mined References (6)

PMID Year Title