Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.70
PubTator Score 1020.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.060 1.3e-02
astrocytic glioma 1.600 2.3e-02
ependymoma 1.900 1.4e-02
intraductal papillary-mucinous carcinoma... -1.100 3.0e-03
lung cancer -2.000 1.4e-05
malignant mesothelioma -1.200 3.7e-06
oligodendroglioma 1.800 9.1e-03
osteosarcoma -2.320 5.2e-05
psoriasis -2.900 3.6e-05
tuberculosis -2.000 2.2e-09

 GO Component (1)

Gene RIF (19)

AA Sequence

MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQ      1 - 70
SKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFK     71 - 140
LKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPEN    141 - 210
HVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINS    211 - 280
FNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPA    281 - 350
QLAPTKVTQPILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKR    351 - 420
PHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDH    421 - 490
RYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELD    491 - 560
RLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPS    561 - 630
PAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMA    631 - 700
DDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSD    701 - 770
RSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA       771 - 837
//

Text Mined References (34)

PMID Year Title