Property Summary

NCBI Gene PubMed Count 27
Grant Count 1,173
R01 Count 790
Funding $80,572,003.21
PubMed Score 38.28
PubTator Score 1020.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytoma 1.800 0.036
ependymoma 1.900 0.014
oligodendroglioma 1.800 0.009
psoriasis -2.900 0.000
osteosarcoma -2.320 0.000
tuberculosis -2.000 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.003
lung cancer -2.000 0.000
ulcerative colitis 1.600 0.000

Synonym

Accession Q9Y6X8
Symbols RAF
AFR1

Gene

PDB

2DMP   3NAU  

Gene RIF (17)

PMID Text
26679602 These results indicated that ZHX2 plays a critical role in the proliferation and osteo/odontogenic differentiation of SCAPs.
25746325 Two novel markers, rs7840785 (PINX1) and rs7844465 (ZHX2), are significantly associated with carotid intima-media thickness.
25473899 Data show that Zinc-fingers and homeoboxes 2 (ZHX2) represses nuclear transcription factor Y alpha (NF-Y)-mediated activation of multidrug resistance 1 (MDR1) transcription.
25195714 Data indicate that zinc-fingers and homeoboxes 2 (ZHX2) suppresses glypican 3 (GPC3) transcription by binding with its core promoter.
22984075 Expression of a constitutively active Raf transgene enhances lymphoproliferation, indicating a role for the Ras-MAPK pathway in linker for activation of T cells (LAT)-mediated autoimmune hyperproliferation.
22661463 simultaneous application of ZFN and rescue DNA induced gene repair of the disease-causing mutation on the genomic level, resulting in recovery of protein expression.
22078940 results demonstrate multiple mechanisms decreasing expression of tumor suppressor gene ZHX2 in Hodgkin lymphoma cell lines
21987443 Expression profiling of L-1236 cells following siRNA-mediated knockdown of ZHX2 showed inhibition of genes regulating differentiation and apoptosis, suggesting tumor suppressor activity of ZHX2.
21443521 There was no significant difference in high and low percentage of HbF in GG, GA, and AA bearing individuals showing that ZHX2 gene variant has no role in ameliorating the severity of beta-thalassemia major in the South Indian population from Andhra Pradesh.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQ      1 - 70
SKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFK     71 - 140
LKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPEN    141 - 210
HVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINS    211 - 280
FNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPA    281 - 350
QLAPTKVTQPILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKR    351 - 420
PHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDH    421 - 490
RYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELD    491 - 560
RLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPS    561 - 630
PAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMA    631 - 700
DDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSD    701 - 770
RSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA       771 - 837
//

Text Mined References (31)

PMID Year Title
26679602 2016 Proliferation and osteo/odontogenic differentiation of stem cells from apical papilla regulated by Zinc fingers and homeoboxes 2: An in vitro study.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25746325 2015 Genetic association and gene-smoking interaction study of carotid intima-media thickness at five GWAS-indicated genes: the Bogalusa Heart Study.
25473899 2015 ZHX2 enhances the cytotoxicity of chemotherapeutic drugs in liver tumor cells by repressing MDR1 via interfering with NF-YA.
25195714 2014 Reduced nucleic ZHX2 involves in oncogenic activation of glypican 3 in human hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22984075 2012 The importance of the Erk pathway in the development of linker for activation of T cells-mediated autoimmunity.
22661463 2012 Gene repair of an Usher syndrome causing mutation by zinc-finger nuclease mediated homologous recombination.
More...