Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.07056082054743E-13
group 4 medulloblastoma 1875 1.29678726141225E-4
glioblastoma 5572 5.69019076102583E-4
medulloblastoma, large-cell 6234 0.00109222341351288
lung cancer 4473 0.00162464673811827
Breast cancer 3099 0.0270162221104319

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma 1.200 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.200 0.001
lung cancer 1.500 0.002
Breast cancer 2.500 0.027
lung carcinoma 1.200 0.000

Synonym

Accession Q9Y6R6 B9EH00
Symbols ZNF779

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSISKPDVITLLEQEKEPWIVVSK      1 - 70
ETSRWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGLEAFYFRNDSEYRSRFEGRQGHQEGYIN     71 - 140
QKIISYEEMPAYTHASPIHNTHKPYECKECGKYFSCGSNLIQHQSIHTGEKPYKCKECGKAFQLHIQLTR    141 - 210
HQKFHTGEKTFECKECGKAFNLPTQLNRHKNIHTVKKLFECKECGKSFNRSSNLTQHQSIHAGVKPYQCK    211 - 280
ECGKAFNRGSNLIQHQKIHSNEKPFVCRECEMAFRYHYQLIEHCRIHTGEKPFECKECRKAFTLLTKLVR    281 - 350
HQKIHMGEKPFECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLIQHQSIHADVKPYECK    351 - 420
ECGKGFNRGANLIQHQKIHSNEKPFVCRECEMAFRYHYQLIQHCQIHTGGKPFECKECGKAFSLLTQLAR    421 - 490
HKNIHTGEKPFECKDCGKAFNRGSNLVQHQSIHTGEKPYECKECGKAFRLHLQLSQHEKTHTGEKPFECK    491 - 560
ECGKFFRRGSNLNQHRSIHTGKKPFECKECGKAFRLHMHLIRHQKFHTGEKPFECKECGKAFSLHTQLNH    561 - 630
HKNIHTGEKPFKCKECGKSFNRVSNLVQHQSIHAGVKPYECKECGKGFSRVSNLIQHQKTHSSAKPFVCK    631 - 700
ECRKTFRYHYQLTEHYRIHTGEKPFECKECGKAFGLLTQLAQHQIIHTGEKPFKCKECGKAFNRGSNLVQ    701 - 770
PQSIHTGEKPYECKECGKAFRLHLQLSLHQKLVQVRNPLNVRNVGQPSDISSNLLNIRKFILG           771 - 833
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.