Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.23
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 4.1e-13
glioblastoma 5792 5.7e-04
group 3 medulloblastoma 4104 1.0e-03
medulloblastoma, large-cell 6241 1.1e-03
lung cancer 4740 1.6e-03
Breast cancer 3578 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.500 2.7e-02
glioblastoma -1.100 5.7e-04
group 3 medulloblastoma 1.100 1.0e-03
lung cancer 1.500 1.6e-03
lung carcinoma 1.200 4.1e-13
medulloblastoma, large-cell -1.200 1.1e-03

AA Sequence

MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSISKPDVITLLEQEKEPWIVVSK      1 - 70
ETSRWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGLEAFYFRNDSEYRSRFEGRQGHQEGYIN     71 - 140
QKIISYEEMPAYTHASPIHNTHKPYECKECGKYFSCGSNLIQHQSIHTGEKPYKCKECGKAFQLHIQLTR    141 - 210
HQKFHTGEKTFECKECGKAFNLPTQLNRHKNIHTVKKLFECKECGKSFNRSSNLTQHQSIHAGVKPYQCK    211 - 280
ECGKAFNRGSNLIQHQKIHSNEKPFVCRECEMAFRYHYQLIEHCRIHTGEKPFECKECRKAFTLLTKLVR    281 - 350
HQKIHMGEKPFECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLIQHQSIHADVKPYECK    351 - 420
ECGKGFNRGANLIQHQKIHSNEKPFVCRECEMAFRYHYQLIQHCQIHTGGKPFECKECGKAFSLLTQLAR    421 - 490
HKNIHTGEKPFECKDCGKAFNRGSNLVQHQSIHTGEKPYECKECGKAFRLHLQLSQHEKTHTGEKPFECK    491 - 560
ECGKFFRRGSNLNQHRSIHTGKKPFECKECGKAFRLHMHLIRHQKFHTGEKPFECKECGKAFSLHTQLNH    561 - 630
HKNIHTGEKPFKCKECGKSFNRVSNLVQHQSIHAGVKPYECKECGKGFSRVSNLIQHQKTHSSAKPFVCK    631 - 700
ECRKTFRYHYQLTEHYRIHTGEKPFECKECGKAFGLLTQLAQHQIIHTGEKPFKCKECGKAFNRGSNLVQ    701 - 770
PQSIHTGEKPYECKECGKAFRLHLQLSLHQKLVQVRNPLNVRNVGQPSDISSNLLNIRKFILG           771 - 833
//

Text Mined References (4)

PMID Year Title