Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.66
PubTator Score 3.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Nager acrofacial dysostosis 21 4.28 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.5e-02
lung carcinoma 2.000 1.7e-29
malignant mesothelioma -2.800 1.9e-06
osteosarcoma 1.683 2.4e-03
primitive neuroectodermal tumor 1.600 1.1e-04

AA Sequence

MSVSSGVQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDPAQSNLYNDVMLENYCNQAS      1 - 70
MGCQAPKPDMISKLEKGEAPWLGKGKRPSQGCPSKIARPKQKETDGKVQKDDDQLENIQKSQNKLLREVA     71 - 140
VKKKTQAKKNGSDCGSLGKKNNLHKKHVPSKKRLLKFESCGKILKQNLDLPDHSRNCVKRKSDAAKEHKK    141 - 210
SFNHSLSDTRKGKKQTGKKHEKLSSHSSSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSS    211 - 280
TKHEKPQACVKPYECNQCGKVLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYE    281 - 350
CIQCGKAHGHKHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSL    351 - 420
TEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYK    421 - 490
CNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHL    491 - 560
IVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSHE    561 - 630
//

Text Mined References (7)

PMID Year Title