Property Summary

NCBI Gene PubMed Count 9
PubMed Score 76.04
PubTator Score 24.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.400 6.7e-04
astrocytic glioma -4.300 3.0e-03
Astrocytoma, Pilocytic -2.100 1.8e-03
atypical teratoid / rhabdoid tumor -4.900 1.5e-09
Breast cancer -4.800 1.7e-32
breast carcinoma -1.700 4.3e-03
ependymoma -5.200 1.1e-03
glioblastoma -3.600 1.7e-07
group 3 medulloblastoma -2.900 2.4e-02
malignant mesothelioma -4.100 4.3e-07
medulloblastoma, large-cell -4.800 1.1e-04
oligodendroglioma -3.300 1.7e-02
Pick disease -1.900 1.4e-02
primitive neuroectodermal tumor -4.100 6.3e-04
subependymal giant cell astrocytoma -1.823 2.5e-02
tuberculosis 1.300 5.2e-06

Gene RIF (4)

AA Sequence

MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPL      1 - 70
NGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGG     71 - 140
PGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIP    141 - 210
DEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQ    211 - 280
NAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDY    281 - 350
EDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE    351 - 420
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSA    421 - 490
DTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDS    491 - 560
IF                                                                        561 - 562
//

Text Mined References (9)

PMID Year Title