Property Summary

NCBI Gene PubMed Count 8
PubMed Score 72.15
PubTator Score 24.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
astrocytic glioma -4.300 0.003
ependymoma -5.200 0.001
oligodendroglioma -3.300 0.017
glioblastoma -5.200 0.000
medulloblastoma -5.300 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -4.100 0.001
tuberculosis 2.100 0.000
breast carcinoma -1.900 0.000
pediatric high grade glioma -4.100 0.000
pilocytic astrocytoma -2.100 0.002
subependymal giant cell astrocytoma -1.823 0.025
Breast cancer -4.800 0.000
Pick disease -1.900 0.014

Synonym

Accession Q9Y6K8 Q5U622 Q6FH66 Q7Z4T5 Q86YS0 Q8N464 Q96EC9 AK 5
Symbols AK6

Gene

AK5

PANTHER Protein Class (3)

PDB

2BWJ  

Gene RIF (3)

PMID Text
23898208 HIV-1 Tat downregulates the expression of adenylate kinase 5 (AK5) in human primary T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19647735 Data demonstrate that human adenylate kinase 5 has two separate functional domains and that both have enzymatic activity.

AA Sequence

MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPL      1 - 70
NGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGG     71 - 140
PGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIP    141 - 210
DEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQ    211 - 280
NAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDY    281 - 350
EDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE    351 - 420
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSA    421 - 490
DTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDS    491 - 560
IF                                                                        561 - 562
//

Publication (8)

PMID Year Title
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19647735 2009 Identification of two active functional domains of human adenylate kinase 5.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10215863 1999 Identification of a novel human adenylate kinase. cDNA cloning, expression analysis, chromosome localization and characterization of the recombinant protein.