Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.52
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.046 2.1e-02
intraductal papillary-mucinous carcinoma... -1.200 3.0e-03
osteosarcoma 2.002 1.0e-03
ovarian cancer -1.300 5.4e-04
tuberculosis 1.100 5.4e-05

Gene RIF (3)

AA Sequence

MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHL      1 - 70
VLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQ     71 - 140
LNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT            141 - 202
//

Text Mined References (24)

PMID Year Title