Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $554,687
PubMed Score 8.83
PubTator Score 2.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 5.089 2.5

Gene RIF (1)

PMID Text
22820855 data indicate that CDY2 and HSFY are located within a segment of the Y chromosome that is important for sperm maturation, and are underexpressed in testicular tissue derived from men with maturation arrest

AA Sequence

MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKKLTWTTT      1 - 70
SRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCKLFAASKNVRRKAASTLSDTKNMEIINSTIE     71 - 140
TLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQ    141 - 210
MSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRGQPFIKKMHFTIRLTES    211 - 280
AITYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDSKLVLFSAAGSVFCCGLDFGY    281 - 350
FVRHLRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTT    351 - 420
FGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIV    421 - 490
LEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF                       491 - 541
//

Text Mined References (15)

PMID Year Title
22820855 2012 Deletion or underexpression of the Y-chromosome genes CDY2 and HSFY is associated with maturation arrest in American men with nonobstructive azoospermia.
19507244 2009 Crystal structures of human CDY proteins reveal a crotonase-like fold.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12575791 2002 A fiber-FISH contig spanning the non-recombining region of the human Y chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438810 2002 Comparative mapping of CDY and DAZ in higher primates.
12149400 2002 Identification and characterization of the cynomolgus monkey chromodomain gene cynCDY, an orthologue of the human CDY gene family.
12072557 2002 Previously uncharacterized histone acetyltransferases implicated in mammalian spermatogenesis.
More...