Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.97
PubTator Score 2.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Spermatogenic Failure, Nonobstructive, Y-Linked 15 0.0 0.0
Disease Target Count
Azoospermia 110
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 3.488 1.7

Gene RIF (1)

AA Sequence

MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKKLTWTTT      1 - 70
SRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCKLFAASKNVRRKAASTLSDTKNMEIINSTIE     71 - 140
TLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQ    141 - 210
MSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRGQPFIKKMHFTIRLTES    211 - 280
AITYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDSKLVLFSAAGSVFCCGLDFGY    281 - 350
FVRHLRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTT    351 - 420
FGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIV    421 - 490
LEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF                       491 - 541
//

Text Mined References (15)

PMID Year Title