Property Summary

NCBI Gene PubMed Count 59
Grant Count 16
R01 Count 10
Funding $1,537,676.69
PubMed Score 87.11
PubTator Score 67.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26531241 Results showed that high level of TACC3 expression was correlated with advanced clinicopathological classifications, and poor prognosis in non-small cell lung cancer patients indicating that TACC3 is a potential prognostic marker.
26219398 TACC3 is enriched in hepatocellular carcinoma and down-regulation inhibits the proliferation, clonogenicity, and cancer stem cell-like phenotype of HCC cells
26134678 TACC3 depletion in human cell lines causes shorter mitotic spindles. co-immunoprecipitation experiments showed reduced binding between TACC3-F543A and Aurora-A.
26133271 The measurement of TACC3 protein expression may be beneficial for predicting clinical outcomes for gastric cancer patients
25760075 TACC3 is expressed in esophageal squamous cell carcinoma and correlates with poor prognosis
25627682 findings suggest that TACC3 could be recruited as a bridge to cooperatively mediate between the HIF-2alpha PAS-B.ARNT PAS-B complex, thereby participating more directly in HIF-dependent gene transcription than previously anticipated
25613365 TACC3 depletion induces G1 arrest and cell death by activating p38-p53-p21 signaling and triggering a centrosome-mediated cellular stress response.
25535896 our data demonstrated the oncogenic role of FGFR3-TACC3 in vitro, indicating that FGFR3-TACC3 may be useful as a diagnostic marker and therapeutic target in cancers.
25294908 FGFR3-TACC3 rearrangements occur in a subset of patients with lung adenocarcinoma. Such patients should be considered for clinical trials featuring FGFR inhibitors.
25246530 TACC3 is involved in the regulation of microtubule nucleation at the centrosome and functions in the stabilization of the gamma-tubulin ring complex assembly
More...

AA Sequence

MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRIL      1 - 70
SPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQKPVEADTDLLGDASPAFGSGS     71 - 140
SSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQAVEENLSSYSLDRRVTPASETLEDPCRTES    141 - 210
QHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVG    211 - 280
TPVPADGTQTLTCAHTSAPESTAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKR    281 - 350
APPPRRLGERSGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG    351 - 420
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAETPTAESKERA    421 - 490
LNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKESALRKQSLY    491 - 560
LKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKLVEFDFLGALDIPVPGPPPGVPAPGGPPLST    561 - 630
GPIVDLLQYSQKDLDAVVKATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAE    631 - 700
IQKVLKEKDQLTTDLNSMEKSFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAH    701 - 770
AEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI      771 - 838
//

Publication (70)

PMID Year Title
26531241 2016 The clinical significance of transforming acidic coiled-coil protein 3 expression in non-small cell lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26219398 2015 TACC3 promotes stemness and is a potential therapeutic target in hepatocellular carcinoma.
26134678 2015 Aurora-A-Dependent Control of TACC3 Influences the Rate of Mitotic Spindle Assembly.
26133271 2015 High expression of transforming acidic coiled coil-containing protein 3 strongly correlates with aggressive characteristics and poor prognosis of gastric cancer.
25760075 2015 High expression of TACC3 in esophageal squamous cell carcinoma correlates with poor prognosis.
25627682 2015 Coiled-coil coactivators play a structural role mediating interactions in hypoxia-inducible factor heterodimerization.
25613365 2015 Suppression of centrosome protein TACC3 induces G1 arrest and cell death through activation of p38-p53-p21 stress signaling pathway.
25596274 2015 TACC3-ch-TOG track the growing tips of microtubules independently of clathrin and Aurora-A phosphorylation.
25535896 2014 Recurrent FGFR3-TACC3 fusion gene in nasopharyngeal carcinoma.
More...