Property Summary

NCBI Gene PubMed Count 67
PubMed Score 101.15
PubTator Score 67.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.326 6.2e-04
adult high grade glioma 1.300 5.3e-04
Atopic dermatitis 1.200 3.8e-05
atypical teratoid / rhabdoid tumor 2.000 5.5e-08
Breast cancer 2.200 4.9e-26
colon cancer 1.400 6.8e-03
Endometriosis 1.626 6.7e-03
glioblastoma 1.800 1.7e-07
group 3 medulloblastoma 2.400 4.0e-06
interstitial cystitis 1.400 6.5e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
invasive ductal carcinoma 1.400 6.4e-04
lung cancer 1.300 4.2e-03
malignant mesothelioma 1.400 1.0e-06
medulloblastoma, large-cell 2.100 5.9e-05
non-small cell lung cancer 1.306 1.8e-18
osteosarcoma -1.554 3.4e-03
ovarian cancer 1.200 2.7e-03
primitive neuroectodermal tumor 2.000 8.7e-05
psoriasis 1.300 1.3e-82

Gene RIF (45)

AA Sequence

MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRIL      1 - 70
SPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQKPVEADTDLLGDASPAFGSGS     71 - 140
SSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQAVEENLSSYSLDRRVTPASETLEDPCRTES    141 - 210
QHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVG    211 - 280
TPVPADGTQTLTCAHTSAPESTAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKR    281 - 350
APPPRRLGERSGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG    351 - 420
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAETPTAESKERA    421 - 490
LNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKESALRKQSLY    491 - 560
LKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKLVEFDFLGALDIPVPGPPPGVPAPGGPPLST    561 - 630
GPIVDLLQYSQKDLDAVVKATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAE    631 - 700
IQKVLKEKDQLTTDLNSMEKSFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAH    701 - 770
AEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI      771 - 838
//

Text Mined References (78)

PMID Year Title