Property Summary

NCBI Gene PubMed Count 10
PubMed Score 40.17
PubTator Score 21.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.07113062538286E-5
Pick disease 1893 0.00126108515023487
Waldenstrons macroglobulinemia 765 0.0050385653070932
chronic rhinosinusitis 512 0.0408859257105688

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.157 0.005
Pick disease -1.100 0.001
ovarian cancer 2.200 0.000
chronic rhinosinusitis -1.057 0.041

Synonym

Accession Q9Y6A4
Symbols GTL3
EVORF
fSAP23
C16orf80

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

 GO Function (1)

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG      1 - 70
IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT     71 - 140
RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ                     141 - 193
//

Text Mined References (13)

PMID Year Title
24414207 2014 Bug22 influences cilium morphology and the post-translational modification of ciliary microtubules.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20118210 2010 Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...