Property Summary

NCBI Gene PubMed Count 10
PubMed Score 40.17
PubTator Score 21.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.157 0.005
Pick disease -1.100 0.001
ovarian cancer 2.200 0.000
chronic rhinosinusitis -1.057 0.041

Synonym

Accession Q9Y6A4
Symbols GTL3
EVORF
fSAP23
C16orf80

Gene

PANTHER Protein Class (2)

 GO Function (1)

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG      1 - 70
IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT     71 - 140
RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ                     141 - 193
//

Publication (13)

PMID Year Title
24414207 2014 Bug22 influences cilium morphology and the post-translational modification of ciliary microtubules.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20118210 2010 Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...