Property Summary

NCBI Gene PubMed Count 12
PubMed Score 43.87
PubTator Score 21.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.057 4.1e-02
ovarian cancer -1.600 2.1e-05
Pick disease -1.100 1.3e-03
Waldenstrons macroglobulinemia 1.157 5.0e-03

 GO Function (1)

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG      1 - 70
IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT     71 - 140
RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ                     141 - 193
//

Text Mined References (15)

PMID Year Title