Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.09
PubTator Score 6779.07

Knowledge Summary

Patent (962)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 1.4e-02
atypical teratoid / rhabdoid tumor -2.000 1.0e-03
chronic rhinosinusitis -1.549 1.3e-02
cystic fibrosis and chronic rhinosinusit... -1.620 2.8e-02
ependymoma -1.100 1.0e-02
glioblastoma -1.800 8.1e-03
group 3 medulloblastoma -1.600 2.2e-02
medulloblastoma, large-cell -2.400 2.8e-04
oligodendroglioma -1.500 3.5e-02
pediatric high grade glioma -1.100 3.2e-02
pituitary cancer -1.300 1.8e-04

Gene RIF (7)

AA Sequence

MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLL      1 - 70
RSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ     71 - 140
KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGG    141 - 210
VAIVAMVKLTQYLSLLCERIQRINR                                                 211 - 235
//

Text Mined References (26)

PMID Year Title