Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.09
PubTator Score 6779.07

Knowledge Summary

Patent (962)

Expression

  Differential Expression (11)

Synonym

Accession Q9Y691
Symbols

Gene

PDB

1JO6  

Gene RIF (7)

PMID Text
24414257 IFN-gamma changed mRNA levels of the BK beta-modulatory proteins KCNMB2 (increased) and KCNMB4 (decreased) as well as leucine-rich repeat-containing protein (LRRC)26 (decreased).
23825428 beta subunits of large-conductance calcium-dependent potassium channels modulate the interface between membrane-spanning and cytosolic domains.
19204046 Report beta subunit (KNMB1-4)-specific modulations of BK channel function by a Slo1 mutation associated with epilepsy and dyskinesia.
17521822 reports that coexpression of beta2 subunit (KCNMB2) with hSlo can also modulate hSlo surface expression levels in HEK293T cells
17460083 significance of inactivation in BK channels mediated by beta subunits arises not from inactivation, but from differences in the amplitude and duration of repolarizing currents arising from the beta-subunit-specific energetics of recovery from inactivation
16446507 results reveal the molecular regions in the beta1 and beta2 subunits that determine their differential functional coupling with the pore-forming alpha-subunit
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLL      1 - 70
RSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ     71 - 140
KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGG    141 - 210
VAIVAMVKLTQYLSLLCERIQRINR                                                 211 - 235
//

Publication (26)

PMID Year Title
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24414257 2014 IFN-?-mediated reduction of large-conductance, Ca2+-activated, voltage-dependent K+ (BK) channel activity in airway epithelial cells leads to mucociliary dysfunction.
23825428 2013 The interface between membrane-spanning and cytosolic domains in Ca²+-dependent K+ channels is involved in ? subunit modulation of gating.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
20859064 2010 Novel spliced variants of large-conductance Ca(2+)-activated K(+)-channel ?2-subunit in human and rodent pancreas.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19204046 2009 {beta} subunit-specific modulations of BK channel function by a mutation associated with epilepsy and dyskinesia.
17521822 2007 Endocytic trafficking signals in KCNMB2 regulate surface expression of a large conductance voltage and Ca(2+)-activated K+ channel.
More...