Property Summary

NCBI Gene PubMed Count 11
PubMed Score 24.75
PubTator Score 20.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.400 4.1e-03
Astrocytoma, Pilocytic 1.900 1.7e-05
Atopic dermatitis -1.300 3.4e-03
atypical teratoid / rhabdoid tumor 1.100 1.9e-04
ependymoma 1.100 1.0e-04
glioblastoma 1.600 4.7e-07
group 3 medulloblastoma 2.000 3.8e-04
invasive ductal carcinoma -1.044 4.2e-03
medulloblastoma, large-cell 2.600 5.8e-06
osteosarcoma 2.381 5.5e-03
ovarian cancer -1.500 2.0e-08
primary pancreatic ductal adenocarcinoma 1.459 1.3e-03
primitive neuroectodermal tumor 1.300 1.8e-02
psoriasis -1.100 5.9e-16
urothelial carcinoma 1.100 2.7e-02

Gene RIF (2)

AA Sequence

MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK      1 - 70
FYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYGSLEEVFLLQNILVSC     71 - 140
HRTTLHVLKCMYLLVLNNNTCAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLY    141 - 210
LQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL                         211 - 259
//

Text Mined References (16)

PMID Year Title