Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.21
PubTator Score 20.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y680 Q4ZG70 Q6V3B2 Q86U65 Q96DA4 Q9Y6B0 PPIase FKBP7
Symbols FKBP23
PPIase

Gene

PANTHER Protein Class (1)

AA Sequence

MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK      1 - 70
FYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYGSLEEVFLLQNILVSC     71 - 140
HRTTLHVLKCMYLLVLNNNTCAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLY    141 - 210
LQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL                         211 - 259
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...