Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.79
PubTator Score 27.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 2.0e-02
Astrocytoma, Pilocytic 1.200 4.5e-06
atypical teratoid / rhabdoid tumor 1.200 1.5e-07
glioblastoma 1.100 7.6e-06
intraductal papillary-mucinous neoplasm ... 2.100 7.0e-03
lung cancer 1.500 1.1e-02
ovarian cancer 1.600 6.3e-04

Protein-protein Interaction (8)

Gene RIF (4)

AA Sequence

MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGL      1 - 70
DYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYIPAVVLYCCCLKEIST     71 - 140
KKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLGISCDCDLLGSLAFCLAINYKQMELYHALPF    141 - 210
FCFLLGKCFKKGLKGKGFVLLVKLACIVVASFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWC    211 - 280
SFNVFLKIKDILPRHIQLIMSFCSTFLSLLPACIKLILQPSSKGFKFTLVSCALSFFLFSFQVHEKSILL    281 - 350
VSLPVCLVLSEIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKS    351 - 420
FSISVRKYLPCFTFLSRIIQYLFLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCLNFLFFLVYFN    421 - 490
IIIMWDSKSGRNQKKIS                                                         491 - 507
//

Text Mined References (21)

PMID Year Title