Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.99
PubTator Score 7.43

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
gastric cancer 2.000 0.000
hepatocellular carcinoma 1.800 0.000
glioblastoma multiforme 2.300 0.000
group 4 medulloblastoma -2.100 0.001
pancreatic ductal adenocarcinoma liver m... -2.657 0.001
tuberculosis -1.500 0.001
sarcoidosis 1.700 0.028
aldosterone-producing adenoma -1.123 0.018
subependymal giant cell astrocytoma 2.513 0.017
lung carcinoma 1.500 0.000
ulcerative colitis 2.600 0.000
ovarian cancer -1.800 0.000
psoriasis 1.200 0.000


Accession Q9Y662 B3KN58 D3DTS6
Symbols 3OST3B1


Gene RIF (5)

24127555 A genome-wide high-throughput siRNA screen revealed that KIR2DL4 recognition of cell-surface ligand(s) is directly regulated by heparan sulfate glucosamine 3-O-sulfotransferase 3B1 (HS3ST3B1).
22475533 Genetic variants of HS3ST3A1 and HS3ST3B1 are associated with Plasmodium falciparum parasitaemia.
21709440 the results from this study unveiled a distinct function for 3-OST-3B1 as an Epithelial-mesenchymal transition inducer in cancer and provided a link between histone modification and Epithelial-mesenchymal transition modulation.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20705311 HS3ST3B1 showed potent inhibitory effect on HBV replication.

AA Sequence

KTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWD                                  351 - 390

Text Mined References (17)

PMID Year Title
24127555 2013 Genome-wide siRNA screen reveals a new cellular partner of NK cell receptor KIR2DL4: heparan sulfate directly modulates KIR2DL4-mediated responses.
23358893 2013 Members of 3-O-Sulfotransferases (3-OST) Family: A Valuable Tool from Zebrafish to Humans for Understanding Herpes Simplex Virus Entry.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22475533 2012 Genetic variations in genes involved in heparan sulphate biosynthesis are associated with Plasmodium falciparum parasitaemia: a familial study in Burkina Faso.
21709440 2011 Heparan sulfate D-glucosaminyl 3-O-sulfotransferase-3B1, a novel epithelial-mesenchymal transition inducer in pancreatic cancer.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20705311 2010 Heparin sulphate D-glucosaminyl 3-O-sulfotransferase 3B1 plays a role in HBV replication.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304505 2004 Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1.