Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.98
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma -1.123 1.8e-02
gastric cancer 2.000 2.2e-04
glioblastoma multiforme 2.300 3.2e-09
group 4 medulloblastoma -2.100 1.3e-03
hepatocellular carcinoma 1.800 1.2e-06
lung carcinoma 1.500 2.3e-11
ovarian cancer -1.800 4.4e-04
pancreatic ductal adenocarcinoma liver m... -2.657 1.2e-03
psoriasis 1.200 7.7e-78
sarcoidosis 1.700 2.8e-02
subependymal giant cell astrocytoma 2.513 1.7e-02
tuberculosis -1.500 1.1e-03
ulcerative colitis 2.600 2.8e-05

Gene RIF (5)

AA Sequence

MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRA      1 - 70
AHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSKQLPQA     71 - 140
IIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEKTPSYFVTREA    141 - 210
PARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHL    211 - 280
EHWLRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLG    281 - 350
KTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWD                                  351 - 390
//

Text Mined References (17)

PMID Year Title