Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.86
PubTator Score 30.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.384 0.007
malignant mesothelioma -3.700 0.000
esophageal adenocarcinoma -1.300 0.020
osteosarcoma -1.082 0.001
ependymoma 1.700 0.000
glioblastoma 1.800 0.001
medulloblastoma 1.700 0.000
cystic fibrosis 1.394 0.000
atypical teratoid / rhabdoid tumor 1.600 0.008
medulloblastoma, large-cell 1.200 0.027
primitive neuroectodermal tumor 1.100 0.028
pancreatic ductal adenocarcinoma liver m... -1.854 0.003
lung cancer 1.700 0.003
fibroadenoma -1.100 0.028
pediatric high grade glioma 1.400 0.001
pilocytic astrocytoma 1.200 0.000
spina bifida -1.224 0.033
ulcerative colitis -1.700 0.000
ovarian cancer 1.800 0.003

Synonym

Accession Q9Y5Z4 Q96P57
Symbols PP23
SOUL
C6orf34
C6ORF34B

Gene

PDB

3R85   3R8J   3R8K   4AYZ   4B0Y  

Gene RIF (6)

PMID Text
23364796 HIV-1 Tat upregulates the expression of heme binding protein 2 (HEBP2; SOUL) in Jurkat cells
21639858 There are important structural differences in the BH3 domain in the intact SOUL molecule and the same sequence bound to Bcl-xL.
19901022 SOUL can be a novel member of the BH3 domain-only proteins that cannot induce cell death alone but can facilitate both outer and inner mitochondrial membrane permeabilization and predominantly necrotic cell death in oxidative stress.
19574650 preliminary X ray structure
19460752 Knockdown of heme binding protein 2 (HEBP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17098234 SOUL promotes necrotic cell death by inducing mitochondrial permeability transition

AA Sequence

MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN      1 - 70
SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR     71 - 140
SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE         141 - 205
//

Publication (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21639858 2011 Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL.
21269460 2011 Initial characterization of the human central proteome.
19901022 2010 Facilitation of mitochondrial outer and inner membrane permeabilization and cell death in oxidative stress by a novel Bcl-2 homology 3 domain protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19574650 2009 Preliminary structural characterization of human SOUL, a haem-binding protein.
More...