Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.86
PubTator Score 30.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Liver neoplasms 109
Disease Target Count P-value
malignant mesothelioma 3163 3.04253629719039E-9
ependymoma 2514 4.31681966818171E-7
ulcerative colitis 2087 1.83938462727648E-6
cystic fibrosis 1670 2.21783236940462E-4
medulloblastoma 1524 3.21291093359574E-4
pilocytic astrocytoma 3086 3.35636625064061E-4
osteosarcoma 7933 8.74482326194496E-4
glioblastoma 5572 0.00148214136635905
pediatric high grade glioma 2712 0.00149082931757425
ovarian cancer 8492 0.00250990106529894
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00276576007479632
lung cancer 4473 0.00337539516400028
Multiple myeloma 1328 0.00696391075796374
atypical teratoid / rhabdoid tumor 4369 0.00812300237528004
esophageal adenocarcinoma 737 0.0195207517873976
medulloblastoma, large-cell 6234 0.0269792636209341
fibroadenoma 557 0.0276556575587492
primitive neuroectodermal tumor 3031 0.0279033273005056
spina bifida 1064 0.0325068334909539

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.384 0.007
malignant mesothelioma -3.700 0.000
esophageal adenocarcinoma -1.300 0.020
osteosarcoma -1.082 0.001
ependymoma 1.700 0.000
glioblastoma 1.800 0.001
medulloblastoma 1.700 0.000
cystic fibrosis 1.394 0.000
atypical teratoid / rhabdoid tumor 1.600 0.008
medulloblastoma, large-cell 1.200 0.027
primitive neuroectodermal tumor 1.100 0.028
pancreatic ductal adenocarcinoma liver m... -1.854 0.003
lung cancer 1.700 0.003
fibroadenoma -1.100 0.028
pediatric high grade glioma 1.400 0.001
pilocytic astrocytoma 1.200 0.000
spina bifida -1.224 0.033
ulcerative colitis -1.700 0.000
ovarian cancer 1.800 0.003

Synonym

Accession Q9Y5Z4 Q96P57
Symbols PP23
SOUL
C6orf34
C6ORF34B

Gene

PDB

3R85   3R8J   3R8K   4AYZ   4B0Y  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (6)

PMID Text
23364796 HIV-1 Tat upregulates the expression of heme binding protein 2 (HEBP2; SOUL) in Jurkat cells
21639858 There are important structural differences in the BH3 domain in the intact SOUL molecule and the same sequence bound to Bcl-xL.
19901022 SOUL can be a novel member of the BH3 domain-only proteins that cannot induce cell death alone but can facilitate both outer and inner mitochondrial membrane permeabilization and predominantly necrotic cell death in oxidative stress.
19574650 preliminary X ray structure
19460752 Knockdown of heme binding protein 2 (HEBP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17098234 SOUL promotes necrotic cell death by inducing mitochondrial permeability transition

AA Sequence

MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN      1 - 70
SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR     71 - 140
SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE         141 - 205
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21639858 2011 Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL.
21269460 2011 Initial characterization of the human central proteome.
19901022 2010 Facilitation of mitochondrial outer and inner membrane permeabilization and cell death in oxidative stress by a novel Bcl-2 homology 3 domain protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19574650 2009 Preliminary structural characterization of human SOUL, a haem-binding protein.
More...