Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.79
PubTator Score 30.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 4.0e-04
atypical teratoid / rhabdoid tumor 1.300 8.0e-06
cystic fibrosis 1.394 2.2e-04
ependymoma 1.100 4.9e-07
esophageal adenocarcinoma -1.300 2.0e-02
fibroadenoma -1.100 2.8e-02
glioblastoma 1.100 1.2e-03
group 3 medulloblastoma 1.700 8.0e-04
lung cancer 1.700 3.4e-03
malignant mesothelioma -3.700 3.0e-09
medulloblastoma, large-cell 1.200 2.7e-02
Multiple myeloma 1.384 7.0e-03
osteosarcoma -1.082 8.7e-04
ovarian cancer -1.300 1.2e-08
pancreatic ductal adenocarcinoma liver m... -1.854 2.8e-03
pediatric high grade glioma 1.400 1.5e-03
primitive neuroectodermal tumor 1.100 2.8e-02
spina bifida -1.224 3.3e-02
ulcerative colitis -1.700 1.8e-06

Gene RIF (7)

AA Sequence

MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN      1 - 70
SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR     71 - 140
SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE         141 - 205
//

Text Mined References (22)

PMID Year Title