Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.97
PubTator Score 10.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Becker muscular dystrophy -1.016 2.2e-02
dermatomyositis 1.100 7.3e-04
Down syndrome 1.200 8.6e-04
juvenile dermatomyositis 1.247 9.7e-09
Multiple myeloma 1.214 9.5e-03
osteosarcoma 1.586 6.0e-05
ovarian cancer -1.300 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.070 4.6e-02
progressive supranuclear palsy -1.700 6.6e-03

Gene RIF (7)

AA Sequence

MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPS      1 - 70
VWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRK     71 - 140
QASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAV    141 - 210
MQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKE    211 - 280
LFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKS    281 - 350
MPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD    351 - 420
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGE    421 - 490
VNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGA    491 - 560
YLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDE    561 - 630
CSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRF    631 - 700
QQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANS    701 - 770
HLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL                     771 - 823
//

Text Mined References (28)

PMID Year Title