Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 6
Funding $491,778.75
PubMed Score 5.64
PubTator Score 10.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Down syndrome 1.200 0.001
Multiple myeloma 1.214 0.009
osteosarcoma 1.586 0.000
Becker muscular dystrophy -1.016 0.022
juvenile dermatomyositis 1.247 0.000
pancreatic ductal adenocarcinoma liver m... -1.070 0.046
progressive supranuclear palsy -1.700 0.007
ovarian cancer 2.600 0.000
dermatomyositis 1.100 0.001

 GO Component (2)

Gene RIF (7)

PMID Text
26323689 The data unveil a unique mechanism by which Usp16 promotes the localization and maintenance of Plk1 on the kinetochores for proper chromosome alignment.
25305019 Data show that histone H2A deubiquitinase USP16 interacts with E3 ubiquitin-protein ligase HERC2, negatively regulates DNA damage-induced ubiquitin foci formation, and is required for termination of the ubiquitin signal.
24025767 in human tissues overexpression of USP16 reduces the expansion of normal fibroblasts and postnatal neural progenitors, whereas downregulation of USP16 partially rescues the proliferation defects of Down's syndrome fibroblasts
24013421 S552P disrupts the interaction between Ubp-M and nuclear export protein CRM1, increasing Ubp-M nuclear retention as cells progress into M phase, revealing a critical function for Ubp-M S552P.
18925961 a new cryptic USP16-RUNX1 fusion in chronic myelomonocytic leukemia
17914355 knockdown of Ubp-M in HeLa cells results in slow cell growth rates owing to defects in the mitotic phase of the cell cycle
17512543 Study reports the solution structure of the BUZ domain of Ubp-M, a ubiquitin-specific protease, and its interaction with ubiquitin; the Ubp-M BUZ domain features three zinc-binding sites consisting of 12 residues.

AA Sequence

MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPS      1 - 70
VWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRK     71 - 140
QASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAV    141 - 210
MQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKE    211 - 280
LFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKS    281 - 350
MPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD    351 - 420
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGE    421 - 490
VNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGA    491 - 560
YLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDE    561 - 630
CSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRF    631 - 700
QQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANS    701 - 770
HLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL                     771 - 823
//

Publication (27)

PMID Year Title
26323689 2015 Usp16 regulates kinetochore localization of Plk1 to promote proper chromosome alignment in mitosis.
25305019 2014 The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.
24025767 2013 Usp16 contributes to somatic stem-cell defects in Down's syndrome.
24013421 2013 Ubp-M serine 552 phosphorylation by cyclin-dependent kinase 1 regulates cell cycle progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20550933 2010 ATM-dependent chromatin changes silence transcription in cis to DNA double-strand breaks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...