Property Summary

NCBI Gene PubMed Count 22
PubMed Score 25.78
PubTator Score 17.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-03
Astrocytoma, Pilocytic -1.500 9.3e-07
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
ependymoma -1.700 5.4e-15
glioblastoma -1.200 1.9e-06
group 4 medulloblastoma 1.700 1.7e-03
malignant mesothelioma -1.600 4.1e-07
medulloblastoma, large-cell -1.500 3.8e-05
non primary Sjogren syndrome sicca 1.100 1.6e-02
osteosarcoma -1.020 4.8e-05
ovarian cancer -1.200 6.2e-10
psoriasis -1.500 9.9e-05

Gene RIF (12)

AA Sequence

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVA      1 - 70
RADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCG     71 - 140
VPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHE    141 - 210
IKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVA    211 - 280
VHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSP    281 - 350
SERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ    351 - 420
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYF    421 - 490
FKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPR    491 - 560
NILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTG    561 - 630
PQPVTYYKRPVQEWV                                                           631 - 645
//

Text Mined References (22)

PMID Year Title