Property Summary

NCBI Gene PubMed Count 21
Grant Count 6
R01 Count 5
Funding $340,080.6
PubMed Score 26.26
PubTator Score 17.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
psoriasis -1.500 0.000
osteosarcoma -2.192 0.000
ependymoma -1.700 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
group 4 medulloblastoma 1.700 0.002
medulloblastoma, large-cell -1.500 0.000
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.400 0.000
non primary Sjogren syndrome sicca 1.100 0.016
ovarian cancer -1.200 0.000

Synonym

Accession Q9Y5R2 B7ZBG8 Q9H440 MMP-24
Symbols MMP25
MMP-24
MT5MMP
MTMMP5
MT-MMP5
MT5-MMP
MT-MMP 5

Gene

Gene RIF (11)

PMID Text
26304632 Polymorphisms in MAP3K3, MMP24 and IGF1R are associated with greater height and act additively on height in children of an admixed population.
24669030 In absolute mRNA levels, significant differences were found in expression of MMP2, MMP24, and MMP25 in gastric carcinoma compared with superficial gastritis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19403421 MMP-24 gene silencing by RNAi can suppress the invasiveness of ovarian cancer SKOV(3) cells in vitro.
18062926 These results suggest more than one human MT5-MMP transcript may exist in the central nervous system.
17952761 MT5-MMP is expressed in normal human endometrium and there is enhanced exprestion in endometrium from patients with entometriosis with strongest signal in epithelial cells.
14990567 MT5-MMP retrieval to the plasma membrane is regulated by Mint-3 by binding to its carboxyl end motif EWV
More...

AA Sequence

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVA      1 - 70
RADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCG     71 - 140
VPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHE    141 - 210
IKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVA    211 - 280
VHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSP    281 - 350
SERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ    351 - 420
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYF    421 - 490
FKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPR    491 - 560
NILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTG    561 - 630
PQPVTYYKRPVQEWV                                                           631 - 645
//

Publication (21)

PMID Year Title
26304632 2015 Association Study of GWAS-Derived Loci with Height in Brazilian Children: Importance of MAP3K3, MMP24 and IGF1R Polymorphisms for Height Variation.
24669030 2014 Expression of the matrix metalloproteases 2, 14, 24, and 25 and tissue inhibitor 3 as potential molecular markers in advanced human gastric cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19403421 2009 [Inhibitory effects of RNA interference on MMP-24 expression and invasiveness of ovarian cancer SKOV(3) cells].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18391951 2008 Many sequence variants affecting diversity of adult human height.
More...