Property Summary

NCBI Gene PubMed Count 33
PubMed Score 15.78
PubTator Score 70.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.692 1.8e-08
Alzheimer's disease -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -1.200 1.6e-04
ductal carcinoma in situ -1.500 8.2e-04
group 3 medulloblastoma -2.400 2.7e-06
Hydrolethalus syndrome 1.074 4.8e-02
invasive ductal carcinoma -1.700 4.2e-03
medulloblastoma, large-cell -1.500 2.4e-06
non diabetic and post-ischemic heart fai... -1.100 3.3e-03
non-small cell lung cancer -1.144 2.7e-10
Pick disease -1.200 2.7e-05
spina bifida 1.039 3.7e-02
tuberculosis -1.300 1.1e-06

Gene RIF (17)

AA Sequence

MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDA      1 - 70
TDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDASPTFFAFLLG     71 - 140
HILAMEVLAWLLIYLLGPGWVPSALAAFILAISQAQSWCLQHDLGHASIFKKSWWNHVAQKFVMGQLKGF    141 - 210
SAHWWNFRHFQHHAKPNIFHKDPDVTVAPVFLLGESSVEYGKKKRRYLPYNQQHLYFFLIGPPLLTLVNF    211 - 280
EVENLAYMLVCMQWADLLWAASFYARFFLSYLPFYGVPGVLLFFVAVRVLESHWFVWITQMNHIPKEIGH    281 - 350
EKHRDWVSSQLAATCNVEPSLFTNWFSGHLNFQIEHHLFPRMPRHNYSRVAPLVKSLCAKHGLSYEVKPF    351 - 420
LTALVDIVRSLKKSGDIWLDAYLHQ                                                 421 - 445
//

Text Mined References (35)

PMID Year Title