Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $263,952
PubMed Score 20.07
PubTator Score 20.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
oligodendroglioma 1.100 0.011
psoriasis 1.400 0.000
ependymoma 1.100 0.000
glioblastoma 1.300 0.001
sonic hedgehog group medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
primitive neuroectodermal tumor 1.200 0.014
Atopic dermatitis 1.100 0.000
pilocytic astrocytoma 1.200 0.004

Synonym

Accession Q9Y5P8 Q6P4G9 Q7RTT1 Q96H01
Symbols PR48
NYREN8
PPP2R3L
PPP2R3LY

Gene

PDB

4I5L   4I5N   4MEW  

Protein-protein Interaction (8)

Gene RIF (1)

PMID Text
25007185 Results show the crystal structure of PR48/PR70, at 2.0 A degrees resolution with two domain elongated structure and two Ca2+ binding EF-hands Scattering data.

AA Sequence

MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPTAPLAAPRPSG      1 - 70
LEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVN     71 - 140
VDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKGPLFYGAGGERTGSVSVHKFVAMWRKILQNC    141 - 210
HDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGR    211 - 280
ITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTK    281 - 350
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ    351 - 420
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLR    421 - 490
DGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAV    491 - 560
DLYEYACGDEDLEPL                                                           561 - 575
//

Publication (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25007185 2014 Structural and biochemical characterization of human PR70 in isolation and in complex with the scaffolding subunit of protein phosphatase 2A.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12605688 2003 Identification and characterization of B"-subunits of protein phosphatase 2 A in Xenopus laevis oocytes and adult tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...