Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.26
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Cholera 34 3.706 1.9

Synonym

Accession Q9Y5M1 Q6NTD6
Symbols APR-2
C17orf88
LINC00530

Gene

 Compartment GO Term (0)

AA Sequence

MVSLWVEGTFPPPGFGLAHVACSGHGMKQKRKPASSEPTPEDALGGSAVPVRFHLHPEGLLWCSRCFFSH      1 - 70
GPKGSEPPGRSAGLQGATERSGRPSVQAQAQACENLVPATVWDG                               71 - 114
//

Text Mined References (6)

PMID Year Title