Property Summary

NCBI Gene PubMed Count 4
Grant Count 6
R01 Count 5
Funding $605,740.67
PubMed Score 1.26
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cholera 33 3.667 1.8
diabetes mellitus 1,663

Synonym

Accession Q9Y5M1 Q6NTD6
Symbols APR-2
C17orf88
LINC00530

Gene

 Compartment GO Term (0)

AA Sequence

MVSLWVEGTFPPPGFGLAHVACSGHGMKQKRKPASSEPTPEDALGGSAVPVRFHLHPEGLLWCSRCFFSH      1 - 70
GPKGSEPPGRSAGLQGATERSGRPSVQAQAQACENLVPATVWDG                               71 - 114
//

Publication (5)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10948432 2000 Improved PCR-based subtractive hybridization strategy for cloning differentially expressed genes.