Property Summary

NCBI Gene PubMed Count 18
Grant Count 23
R01 Count 11
Funding $777,350.6
PubMed Score 66.60
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with translocase of inner mitochondrial membrane 13 homolog (TIMM13) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCM      1 - 70
DRYMDAWNTVSRAYNSRLQRERANM                                                  71 - 95
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17329230 2007 Conserved motifs reveal details of ancestry and structure in the small TIM chaperones of the mitochondrial intermembrane space.
16387659 2006 Crystal structure of the mitochondrial chaperone TIM9.10 reveals a six-bladed alpha-propeller.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...