Property Summary

NCBI Gene PubMed Count 19
PubMed Score 75.73
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCM      1 - 70
DRYMDAWNTVSRAYNSRLQRERANM                                                  71 - 95
//

Text Mined References (24)

PMID Year Title