Tbio | Ubiquitin carboxyl-terminal hydrolase isozyme L5 |
Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 4.85451222326212E-19 |
ovarian cancer | 8492 | 5.30182463293538E-4 |
psoriasis | 6685 | 6.2786779807352E-4 |
invasive ductal carcinoma | 2950 | 0.00133304160293069 |
hereditary spastic paraplegia | 313 | 0.0032457046757948 |
lung cancer | 4473 | 0.00610470939083395 |
astrocytic glioma | 2241 | 0.0413671772028788 |
oligodendroglioma | 2849 | 0.0426498484336382 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.400 | 0.041 |
oligodendroglioma | -1.400 | 0.043 |
psoriasis | 1.100 | 0.001 |
hereditary spastic paraplegia | -1.079 | 0.003 |
non-small cell lung cancer | 1.026 | 0.000 |
lung cancer | 2.300 | 0.006 |
invasive ductal carcinoma | 1.200 | 0.001 |
ovarian cancer | 1.200 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26907685 | this work implicates hRpn13 and Uch37 in cell cycle progression, providing a rationale for their function in cellular proliferation and for the apoptotic effect of the hRpn13-targeting molecule RA190. |
26396186 | These results uncover a novel mechanism for E2F1 transcriptional activation through removal of its Lys-63-linked ubiquitination by UCH37. |
25702872 | Data indicate that ubiquitin thioesterase L5 UCH37 (UCHL5) comprises a catalytic UCH domain followed by the four-helix (alpha8-alpha11) C-terminal domain. |
25702870 | Data show that DEUBAD domain in RPN13 (ADRM1) activates ubiquitin thioesterase L5 (UCH-L5), and the related DEUBAD domain in INO80G (NFRKB) inhibits UCH-L5. |
25123264 | High expression of UCH37 is significantly associated with epithelial ovarian cancer. |
24319254 | b-AP15 is an inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance. |
23220010 | UCH37 over-expression is associated with hepatocellular carcinoma recurrence. |
22615012 | UCH37 is associated with outcome and recurrence of ESCC and can be a novel predictor for poor prognosis of esophageal squamous cell carcinoma patients after curative resection. |
21995438 | our structures reveal conformationally dynamic parts of the enzyme that may play a role in the structural transition to the more active form. |
21953935 | Uch37 consists of two domains, a globular UCH-domain and a fibrous C-terminal tail. The C-terminal residues of Uch37 are implicated in Rpn13 binding. |
More... |
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ 1 - 70 DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH 71 - 140 NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK 141 - 210 YSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR 211 - 280 YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK 281 - 329 //
PMID | Year | Title |
---|---|---|
26907685 | 2016 | The Proteasome Ubiquitin Receptor hRpn13 and Its Interacting Deubiquitinating Enzyme Uch37 Are Required for Proper Cell Cycle Progression. |
26396186 | 2015 | Regulation of E2 promoter binding factor 1 (E2F1) transcriptional activity through a deubiquitinating enzyme, UCH37. |
25702872 | 2015 | Structural basis for the activation and inhibition of the UCH37 deubiquitylase. |
25702870 | 2015 | Mechanism of UCH-L5 activation and inhibition by DEUBAD domains in RPN13 and INO80G. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25123264 | 2014 | High expression of UCH37 is significantly associated with poor prognosis in human epithelial ovarian cancer. |
24319254 | 2014 | A novel small molecule inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23220010 | 2013 | Ubiquitin C-terminal Hydrolase 37, a novel predictor for hepatocellular carcinoma recurrence, promotes cell migration and invasion via interacting and deubiquitinating PRP19. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
More... |