Property Summary

NCBI Gene PubMed Count 38
PubMed Score 41.96
PubTator Score 37.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.85451222326212E-19
ovarian cancer 8492 5.30182463293538E-4
psoriasis 6685 6.2786779807352E-4
invasive ductal carcinoma 2950 0.00133304160293069
hereditary spastic paraplegia 313 0.0032457046757948
lung cancer 4473 0.00610470939083395
astrocytic glioma 2241 0.0413671772028788
oligodendroglioma 2849 0.0426498484336382

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 0.041
oligodendroglioma -1.400 0.043
psoriasis 1.100 0.001
hereditary spastic paraplegia -1.079 0.003
non-small cell lung cancer 1.026 0.000
lung cancer 2.300 0.006
invasive ductal carcinoma 1.200 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q9Y5K5 Q5LJA6 Q5LJA7 Q8TBS4 Q96BJ9 Q9H1W5 Q9P0I3 Q9UQN2 UCH-L5
Symbols UCH37
CGI-70
INO80R
UCH-L5

Gene

PANTHER Protein Class (3)

PDB

3A7S   3IHR   3RII   3RIS   3TB3   4UEL   4UEM   4UF5   4UF6   4WLP  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (19)

PMID Text
26907685 this work implicates hRpn13 and Uch37 in cell cycle progression, providing a rationale for their function in cellular proliferation and for the apoptotic effect of the hRpn13-targeting molecule RA190.
26396186 These results uncover a novel mechanism for E2F1 transcriptional activation through removal of its Lys-63-linked ubiquitination by UCH37.
25702872 Data indicate that ubiquitin thioesterase L5 UCH37 (UCHL5) comprises a catalytic UCH domain followed by the four-helix (alpha8-alpha11) C-terminal domain.
25702870 Data show that DEUBAD domain in RPN13 (ADRM1) activates ubiquitin thioesterase L5 (UCH-L5), and the related DEUBAD domain in INO80G (NFRKB) inhibits UCH-L5.
25123264 High expression of UCH37 is significantly associated with epithelial ovarian cancer.
24319254 b-AP15 is an inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
23220010 UCH37 over-expression is associated with hepatocellular carcinoma recurrence.
22615012 UCH37 is associated with outcome and recurrence of ESCC and can be a novel predictor for poor prognosis of esophageal squamous cell carcinoma patients after curative resection.
21995438 our structures reveal conformationally dynamic parts of the enzyme that may play a role in the structural transition to the more active form.
21953935 Uch37 consists of two domains, a globular UCH-domain and a fibrous C-terminal tail. The C-terminal residues of Uch37 are implicated in Rpn13 binding.
More...

AA Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ      1 - 70
DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH     71 - 140
NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK    141 - 210
YSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR    211 - 280
YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK                         281 - 329
//

Text Mined References (42)

PMID Year Title
26907685 2016 The Proteasome Ubiquitin Receptor hRpn13 and Its Interacting Deubiquitinating Enzyme Uch37 Are Required for Proper Cell Cycle Progression.
26396186 2015 Regulation of E2 promoter binding factor 1 (E2F1) transcriptional activity through a deubiquitinating enzyme, UCH37.
25702872 2015 Structural basis for the activation and inhibition of the UCH37 deubiquitylase.
25702870 2015 Mechanism of UCH-L5 activation and inhibition by DEUBAD domains in RPN13 and INO80G.
25416956 2014 A proteome-scale map of the human interactome network.
25123264 2014 High expression of UCH37 is significantly associated with poor prognosis in human epithelial ovarian cancer.
24319254 2014 A novel small molecule inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23220010 2013 Ubiquitin C-terminal Hydrolase 37, a novel predictor for hepatocellular carcinoma recurrence, promotes cell migration and invasion via interacting and deubiquitinating PRP19.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...