Property Summary

NCBI Gene PubMed Count 44
PubMed Score 51.89
PubTator Score 37.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.015 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 4.1e-02
hereditary spastic paraplegia -1.079 3.2e-03
invasive ductal carcinoma 1.200 1.3e-03
lung cancer 2.300 6.1e-03
non-small cell lung cancer 1.026 4.9e-19
oligodendroglioma -1.400 4.3e-02
ovarian cancer 1.200 5.3e-04
psoriasis 1.100 6.3e-04

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ      1 - 70
DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH     71 - 140
NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK    141 - 210
YSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR    211 - 280
YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK                         281 - 329
//

Text Mined References (48)

PMID Year Title