Property Summary

NCBI Gene PubMed Count 38
Grant Count 33
R01 Count 23
Funding $3,832,244.55
PubMed Score 41.96
PubTator Score 37.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 0.041
oligodendroglioma -1.400 0.043
psoriasis 1.100 0.001
hereditary spastic paraplegia -1.079 0.003
non-small cell lung cancer 1.026 0.000
lung cancer 2.300 0.006
invasive ductal carcinoma 1.200 0.001
ovarian cancer 1.200 0.001

Gene RIF (19)

PMID Text
26907685 this work implicates hRpn13 and Uch37 in cell cycle progression, providing a rationale for their function in cellular proliferation and for the apoptotic effect of the hRpn13-targeting molecule RA190.
26396186 These results uncover a novel mechanism for E2F1 transcriptional activation through removal of its Lys-63-linked ubiquitination by UCH37.
25702872 Data indicate that ubiquitin thioesterase L5 UCH37 (UCHL5) comprises a catalytic UCH domain followed by the four-helix (alpha8-alpha11) C-terminal domain.
25702870 Data show that DEUBAD domain in RPN13 (ADRM1) activates ubiquitin thioesterase L5 (UCH-L5), and the related DEUBAD domain in INO80G (NFRKB) inhibits UCH-L5.
25123264 High expression of UCH37 is significantly associated with epithelial ovarian cancer.
24319254 b-AP15 is an inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
23220010 UCH37 over-expression is associated with hepatocellular carcinoma recurrence.
22615012 UCH37 is associated with outcome and recurrence of ESCC and can be a novel predictor for poor prognosis of esophageal squamous cell carcinoma patients after curative resection.
21995438 our structures reveal conformationally dynamic parts of the enzyme that may play a role in the structural transition to the more active form.
21953935 Uch37 consists of two domains, a globular UCH-domain and a fibrous C-terminal tail. The C-terminal residues of Uch37 are implicated in Rpn13 binding.
More...

AA Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ      1 - 70
DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH     71 - 140
NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK    141 - 210
YSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR    211 - 280
YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK                         281 - 329
//

Text Mined References (42)

PMID Year Title
26907685 2016 The Proteasome Ubiquitin Receptor hRpn13 and Its Interacting Deubiquitinating Enzyme Uch37 Are Required for Proper Cell Cycle Progression.
26396186 2015 Regulation of E2 promoter binding factor 1 (E2F1) transcriptional activity through a deubiquitinating enzyme, UCH37.
25702872 2015 Structural basis for the activation and inhibition of the UCH37 deubiquitylase.
25702870 2015 Mechanism of UCH-L5 activation and inhibition by DEUBAD domains in RPN13 and INO80G.
25416956 2014 A proteome-scale map of the human interactome network.
25123264 2014 High expression of UCH37 is significantly associated with poor prognosis in human epithelial ovarian cancer.
24319254 2014 A novel small molecule inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23220010 2013 Ubiquitin C-terminal Hydrolase 37, a novel predictor for hepatocellular carcinoma recurrence, promotes cell migration and invasion via interacting and deubiquitinating PRP19.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...