Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -2.000 3.2e-05
ductal carcinoma in situ -1.100 8.0e-05
group 3 medulloblastoma 1.500 7.6e-03
interstitial cystitis -1.200 5.0e-03
intraductal papillary-mucinous adenoma (... -2.400 5.3e-03
intraductal papillary-mucinous carcinoma... -2.600 5.1e-04
intraductal papillary-mucinous neoplasm ... -2.100 1.8e-02
invasive ductal carcinoma -1.400 1.0e-04
lung carcinoma 2.700 7.9e-25
medulloblastoma, large-cell 1.200 2.5e-02
oligodendroglioma 1.200 2.6e-03
ovarian cancer 1.200 2.2e-02
pediatric high grade glioma 1.300 3.3e-03
psoriasis -1.100 1.2e-25

AA Sequence

METALAKTPQKRQVMFLAILLLLWEAGSEAVRYSIPEETESGYSVANLAKDLGLGVGELATRGARMHYKG      1 - 70
NKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEKEMLL     71 - 140
KIPESTQPGTVFPLKIAQDFDIGSNTVQNYTISPNSHFHVATHNRGDGRKYPELVLDKALDREERPELSL    141 - 210
TLTALDGGAPPRSGTTTIRIVVLDNNDNAPEFLQSFYEVQVPENSPLNSLVVVVSARDLDAGAYGSVAYA    211 - 280
LFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIVATDGGGLSGKCTVAIEVVDVNDNAPELTMST    281 - 350
LSSPTPENAPETVVAVFSVSDPDSGDNGRMICSIQNDLPFLLKPTLKNFYTLVTQRTLDRESQAEYNITI    351 - 420
TVTDMGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLL    421 - 490
PPQNPHLRLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRVLVLDANDNSPFV    491 - 560
LYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFSMWAHNGEVRTARLLS    561 - 630
ERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLF    631 - 700
LFSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGHLVDVSGTGTLSQSYHYEVCLTGDSGAGEFKFLKPII    701 - 770
PNLLPQGAGEEIGKTAAFRNSFGLN                                                 771 - 795
//

Text Mined References (13)

PMID Year Title