Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.78
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.400 3.6e-02
Astrocytoma, Pilocytic 2.200 2.2e-05
Breast cancer -1.100 4.7e-04
glioblastoma 1.500 4.7e-03
group 4 medulloblastoma 2.900 4.2e-08
intraductal papillary-mucinous adenoma (... -1.500 3.2e-03
intraductal papillary-mucinous carcinoma... -1.500 4.5e-03
lung carcinoma 1.100 1.9e-14
pituitary cancer -1.400 4.5e-04

AA Sequence

MEARVERAVQKRQVLFLCVFLGMSWAGAEPLRYFVAEETERGTFLTNLAKDLGLGVGELRARGTRIVSDQ      1 - 70
NMQILLLSSLTGDLLLNEKLDREELCGPREPCVLPFQLLLEKPFQIFRAELWVRDINDHAPVFLDREISL     71 - 140
KILESTTPGAAFLLESAQDSDVGTNSLSNYTISPNAYFHINVHDSGEGNIYPELVLNQVLDREEIPEFSL    141 - 210
TLTALDGGSPPRSGTALVRILVLDVNDNAPDFVRSLYKVQVPENSPVGSMVVSVSARDLDTGSNGEIAYA    211 - 280
FSYATERILKTFQINPTSGSLHLKAQLDYEAIQTYTLTIQAKDGGGLSGKCTVVVDVTDINDNRPELLLS    281 - 350
SLTSPIAENSPETVVAVFRIRDRDSGNNGKTVCSIQDDVPFILKPSVENFYTLVTEKPLDRERNTEYNIT    351 - 420
ITVTDLGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALPIGSVSATDRDSGTNAQVIYSL    421 - 490
LPSQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNSSAPCTEPLPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLRLPEAAPDQANSLTVYLVVALASVSSLFL    631 - 700
LSVLLFVAVRLCRRSRAAPVGRCSVPEGPFPRHLVDLSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPIIP    701 - 770
NLLPQSTGREVEENRPFQNNLGF                                                   771 - 793
//

Text Mined References (11)

PMID Year Title