Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.400 2.2e-04
astrocytic glioma 1.100 2.3e-02
atypical teratoid / rhabdoid tumor 1.400 9.2e-05
glioblastoma 1.400 7.4e-04
group 4 medulloblastoma 1.600 1.2e-05
lung carcinoma 1.900 5.7e-21
medulloblastoma, large-cell 1.600 5.8e-06
primitive neuroectodermal tumor 1.300 2.4e-03

Gene RIF (1)

AA Sequence

MKTRGFSFPRQRQVLFLFLFWGVSLAGSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDD      1 - 70
NKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRDINDHSPVFRHKEMVL     71 - 140
KISENTAEGTAFRLERAQDPDEGHNSIQNYTISSNSFFHIKISGSDEGMIYPELVLDKALDREEQEELSL    141 - 210
TLTALDGGSPSRSGTSTIRIVVLDVNDNAPQFAQALYETQAPENSPVGSLIVKVSAGDADSGVNAEVSYS    211 - 280
FFDASEDILTTFQINPFSGEIFLRELLDYELVNSYKINIQAMDGGGLSARCTVLIKVLDSNDNPPELIIS    281 - 350
SLSNSVAENSPGIVLAVFKIKDRDSGENGKTICYVQDNLPFFLKPSVDNFYILMTEGALDRESKAEYNIT    351 - 420
ITVTDLGTPRLKTEHSITLQVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSL    421 - 490
LPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFDFRVGASDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADLLTVYLVVALASVSSL    631 - 700
FLLSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGHLVDVSGTGTLFQSYQYEVCLTGGSETGEFKFLKPI    701 - 770
TPHLPPHRGGKEIEENSTLPNSFGFNY                                               771 - 797
//

Text Mined References (11)

PMID Year Title