Property Summary

NCBI Gene PubMed Count 83
PubMed Score 113.52
PubTator Score 67.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
gastric carcinoma -2.000 6.9e-03
nephrosclerosis -1.196 4.7e-02
ovarian cancer -1.300 6.0e-07
pancreatic ductal adenocarcinoma liver m... -3.378 4.5e-03

Gene RIF (61)

AA Sequence

MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQIND      1 - 70
IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKY     71 - 140
LEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQE    141 - 210
PTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGS    211 - 280
PWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFY    281 - 350
LGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP    351 - 420
RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE                                  421 - 460
//

Text Mined References (92)

PMID Year Title