Property Summary

NCBI Gene PubMed Count 76
Grant Count 13
R01 Count 9
Funding $1,667,978.71
PubMed Score 87.63
PubTator Score 67.62

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
nephrosclerosis -1.196 0.047
pancreatic ductal adenocarcinoma liver m... -3.378 0.004
gastric carcinoma -2.000 0.007
ovarian cancer -1.300 0.000

Gene RIF (54)

27053679 An ANGPTL3-4-8 model was proposed to explain the variations of lipoprotein lipase (LPL) activity during the fed-fast cycle. Feeding induces ANGPTL8, activating the ANGPTL8-ANGPTL3 pathway, which inhibits LPL in cardiac and skeletal muscles to direct circulating triglycerides (TG) to white adipose tissue; the reverse is true during fasting, which suppresses ANGPTL8 but induces ANGPTL4, thereby directing TG to muscles.
26739706 ANGPTL3 levels were associated with fasting insulin and the homeostasis model assessment of insulin resistance in Korean children.
25954050 Inactivation of ANGPTL3 reduces hepatic VLDL-triglyceride secretion
25733326 Novel mutation Y344S found in ANGPTL3 gene in two diabetic patients with familial hypobetalipoproteinemia.
25495645 Data suggest that silencing of ANGPTL 3 (angiopoietin-like protein 3) improves insulin sensitivity.
24768220 Data suggest that genetic polymorphisms in ANGPTL3 (angiopoietin-like 3 protein), TIMD4 (T cell immunoglobulin mucin-4), and apolipoproteins A5 and B are among the genetic determinants of hypertriglyceridemia in Amerindian populations. [REVIEW]
24626437 ANGPTL3 is positively associated with low-density lipoprotein cholesterol and high-density lipoprotein cholesterol and not with metabolic syndrome traits including triglycerides.
23978712 HCV core represses ANGPTL-3 expression through loss of HNF-1alpha binding activity and blockage of LXR/RXR transactivation
23839332 Identification of loss-of-function ANGPTL3 mutation is shedding light on a possible role of ANGPTL3 at the crossroads of lipoproteins, fatty acids, and glucose metabolism. [Review]
23661675 Although partial Angptl3 deficiency did not affect the activities of lipolytic enzymes, the complete absence of Angptl3 results in an increased lipoprotein lipase activity and mass and low circulating free fatty acid levels.

AA Sequence

RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE                                  421 - 460

Publication (85)

PMID Year Title
27053679 2016 The ANGPTL3-4-8 model, a molecular mechanism for triglyceride trafficking.
26739706 2016 Circulating angiopoietin-like protein 8 (ANGPTL8) and ANGPTL3 concentrations in relation to anthropometric and metabolic profiles in Korean children: a prospective cohort study.
26204133 2015 Regulation of Angiopoietin-Like Proteins (ANGPTLs) 3 and 8 by Insulin.
25954050 2015 Inactivation of ANGPTL3 reduces hepatic VLDL-triglyceride secretion.
25733326 2015 Clinical and genetic analysis of a family diagnosed with familial hypobetalipoproteinemia in which the proband was diagnosed with diabetes mellitus.
25710887 2015 A novel role of angiopoietin-like-3 associated with podocyte injury.
25495645 2014 Silencing of ANGPTL 3 (angiopoietin-like protein 3) in human hepatocytes results in decreased expression of gluconeogenic genes and reduced triacylglycerol-rich VLDL secretion upon insulin stimulation.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24768220 2014 Genetic and environmental determinants of the susceptibility of Amerindian derived populations for having hypertriglyceridemia.
24626437 2014 Differential association of plasma angiopoietin-like proteins 3 and 4 with lipid and metabolic traits.