Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.89
PubTator Score 2.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.123 3.2e-03
cystic fibrosis and chronic rhinosinusit... -1.061 3.1e-02
osteosarcoma -2.120 7.1e-07
ovarian cancer -1.400 2.3e-04
posterior fossa group B ependymoma 1.700 9.3e-07

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MDTFPNNFPPGGDSGLTGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQ      1 - 70
TQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVY     71 - 140
NKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKV    141 - 210
YLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSS    211 - 280
EQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEIL    281 - 350
KAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEE    351 - 420
KLRASQMAEEITRKELQSVRLKLQQQIVTIENAEKEKNENSDLKQQISSLQIQVTSLAQSENDLLNSNQM    421 - 490
LKEMVERLKQECRNFRSQAEKAQLEAEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEKLQRAAIAQK    491 - 560
KRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNM    561 - 630
PPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSLLRKRLEELETTQRKQLEELGSSGE           631 - 693
//

Text Mined References (11)

PMID Year Title