Property Summary

NCBI Gene PubMed Count 9
PubMed Score 840.05
PubTator Score 20.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.3e-07
atypical teratoid / rhabdoid tumor 1.600 6.0e-06
ependymoma 1.700 3.5e-15
glioblastoma 1.300 3.6e-04
group 3 medulloblastoma 1.300 1.6e-04
intraductal papillary-mucinous carcinoma... 1.100 8.2e-03
medulloblastoma, large-cell 1.300 1.3e-04
osteosarcoma 1.641 4.7e-06
pediatric high grade glioma 1.300 7.6e-06

AA Sequence

MANEDCPKAADSPFSSDKHAQLILAQINKMRNGQHFCDVQLQVGQESFKAHRLVLAASSPYFAALFTGGM      1 - 70
KESSKDVVPILGIEAGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCI     71 - 140
GIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTKDQLIKILRSEELSIEDEYQVFLAAMQWILK    141 - 210
DLGKRRKHVVEVLDPIRFPLLPPQRLLKYIEGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKV    211 - 280
RPRKKARKYLYAVGGYTRLQGGRWSDSRALSCVERFDTFSQYWTTVSSLHQARSGLGVTVLGGMVYAIGG    281 - 350
EKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPDENKWEVV    351 - 420
GNMAVSRYYFGCCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAALNDCIYSV    421 - 490
GGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCVVAVNGLLYVSGGRSSSHDFLAPGTLDSVEVYN    491 - 560
PHSDTWTEIGNMITSRCEGGVAVL                                                  561 - 584
//

Text Mined References (11)

PMID Year Title