Property Summary

NCBI Gene PubMed Count 9
Grant Count 88
R01 Count 42
Funding $11,530,628.5
PubMed Score 782.85
PubTator Score 20.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q9Y573 A2A6V4 D3DQ11 Q8N5C3
Symbols KLHL27

Gene

IPP

AA Sequence

MANEDCPKAADSPFSSDKHAQLILAQINKMRNGQHFCDVQLQVGQESFKAHRLVLAASSPYFAALFTGGM      1 - 70
KESSKDVVPILGIEAGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCI     71 - 140
GIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTKDQLIKILRSEELSIEDEYQVFLAAMQWILK    141 - 210
DLGKRRKHVVEVLDPIRFPLLPPQRLLKYIEGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKV    211 - 280
RPRKKARKYLYAVGGYTRLQGGRWSDSRALSCVERFDTFSQYWTTVSSLHQARSGLGVTVLGGMVYAIGG    281 - 350
EKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPDENKWEVV    351 - 420
GNMAVSRYYFGCCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAALNDCIYSV    421 - 490
GGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCVVAVNGLLYVSGGRSSSHDFLAPGTLDSVEVYN    491 - 560
PHSDTWTEIGNMITSRCEGGVAVL                                                  561 - 584
//

Text Mined References (11)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11536049 2001 Cloning and characterization of ectopically expressed transcripts for the actin-binding protein MIPP in mouse mammary carcinomas.
10072760 1999 Isolation and characterization of IPP, a novel human gene encoding an actin-binding, kelch-like protein.
8432546 1993 The IPP gene is assigned to human chromosome 1p32-1p22.
1906605 1991 Identification of a novel murine IAP-promoted placenta-expressed gene.
More...