Property Summary

NCBI Gene PubMed Count 14
PubMed Score 90.20
PubTator Score 8.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Liver disease 237 0.0 1.0
Disease Target Count Z-score Confidence
Muscular atrophy 71 4.885 2.4
Denys-Drash syndrome 12 3.022 1.5

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQ      1 - 70
KKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNL     71 - 140
SNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVSYSFLEIVCVYGYSLF    141 - 210
IYIPTAILWIIPQKAVRWILVMIALGISGSLLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYF    211 - 280
FDAPEMDHLPTTTATPNQTVAAAKSS                                                281 - 306
//

Text Mined References (16)

PMID Year Title