Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.87
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQEL      1 - 70
PASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPS     71 - 140
APAPAPASAPEPASAPVPSPPSPPCGPGLWRPW                                         141 - 173
//

Text Mined References (8)

PMID Year Title