Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
Funding $486,141
PubMed Score 1.87
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQEL      1 - 70
PASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPS     71 - 140
APAPAPASAPEPASAPVPSPPSPPCGPGLWRPW                                         141 - 173
//

Publication (8)

PMID Year Title
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254753 2004 Identification and characterization of human HES2, HES3, and HES5 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570950 1998 Structure, chromosomal locus, and promoter of mouse Hes2 gene, a homologue of Drosophila hairy and Enhancer of split.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.