Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.04
PubTator Score 5.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.3e-03
lung cancer 4740 1.4e-02
osteosarcoma 7950 1.7e-02
Breast cancer 3578 4.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.700 4.3e-02
lung cancer 1.100 1.4e-02
osteosarcoma -1.026 1.7e-02
ovarian cancer -1.500 4.3e-03

Synonym

Accession Q9Y530 A6NEK4 A8K4H4 Q96F23
Symbols TARG1
C6orf130
dJ34B21.3

Gene

PDB

2EEE   2L8R   2LGR   4J5Q   4J5R   4J5S  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAV      1 - 70
LKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVF     71 - 140
EATDIKITVYTL                                                              141 - 152
//

Text Mined References (12)

PMID Year Title